KEGG   Meriones unguiculatus (Mongolian gerbil): 110556211
Entry
110556211         CDS       T05884                                 

Gene name
Pdia3
Definition
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  protein disulfide-isomerase A3 [EC:5.3.4.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04141  Protein processing in endoplasmic reticulum
mun04612  Antigen processing and presentation
mun05163  Human cytomegalovirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110556211 (Pdia3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110556211 (Pdia3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110556211 (Pdia3)
   05168 Herpes simplex virus 1 infection
    110556211 (Pdia3)
   05163 Human cytomegalovirus infection
    110556211 (Pdia3)
   05169 Epstein-Barr virus infection
    110556211 (Pdia3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mun03110]
    110556211 (Pdia3)
   04131 Membrane trafficking [BR:mun04131]
    110556211 (Pdia3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110556211 (Pdia3)
Enzymes [BR:mun01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     110556211 (Pdia3)
Chaperones and folding catalysts [BR:mun03110]
 Protein folding catalysts
  Protein disulfide isomerase
   110556211 (Pdia3)
Membrane trafficking [BR:mun04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    110556211 (Pdia3)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   110556211 (Pdia3)
  Exosomal proteins of colorectal cancer cells
   110556211 (Pdia3)
  Exosomal proteins of bladder cancer cells
   110556211 (Pdia3)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 OST3_OST6 Thioredoxin_4 AhpC-TSA Thioredoxin_3
Other DBs
NCBI-GeneID: 110556211
NCBI-ProteinID: XP_021505521
LinkDB
Position
Unknown
AA seq 505 aa
MRFGRLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRD
NYRFAHTNIESLVKEYDDNGEGITLFRPSHLANKFEDKTVAYNEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLTFA
VASRKTFSHELSDFGLESTTGEVPVVAVRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPETNDGPVKVVVAENFDEIVNDADKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANQKLNPKKYEGGRELNDFVSYL
QKEATNPPIIQEEKPKKKKKAQEDL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgcgcttcggccgcctagcgctgctcccgggcgtggcgctgctgctcgcctcggcccgc
ctcgccgccgcctccgacgtgttggaactcacggacgaaaacttcgagagtcgcgtctcc
gacacgggctcggcggggctcatgctagtcgagttcttcgcgccctggtgtggacattgc
aagaggcttgcccctgaatatgaagctgcagcaactagattaaaaggaatagtcccgtta
gcaaaggtggattgcactgccaacacaaacacctgtaataagtatggagtcagtggctac
ccaacccttaaaatatttagagatggtgaagaagcaggtgcttatgatgggcctaggact
gcagatggaattgtcagtcacttgaagaaacaagcaggaccagcttccgttcctctcagg
actgaggaggaatttaagaagttcattagtgataaagatgcctcggttgtgggttttttc
agggatttattcagtgatgggcactccgagttcctgaaagcagccagcaacttgagagat
aactaccgatttgcacataccaacattgagtctctggtgaaggaatacgatgataatgga
gaggggatcactttatttcgcccttcacatcttgctaacaagtttgaagacaaaaccgtg
gcatacaatgaacagaaaatgaccagcggcaagattaaaaagtttattcaggaaaacatt
tttggtatctgtcctcatatgacagaagacaataaagatttgatacaaggcaaggactta
cttacagcttactatgatgtggactatgaaaagaatgctaagggttccaactattggaga
aacagggtgatgatggtggcaaagaaattccttgatgctggacacaaactcacctttgct
gtagctagccgtaaaacctttagccatgaactgtccgattttggcttggaaagcactact
ggagaggttcctgttgtggctgtcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgggatggcaaggctcttgaaaggttcctgcaggattactttgatggcaac
ctgaagagatacctgaaatctgaacctatcccagagactaacgacgggcctgtcaaggtt
gtggtagcagaaaattttgatgaaatagtgaatgatgcagataaggacgtactgattgag
ttttatgctccttggtgtggtcactgtaagaatctggaacccaaatacaaagagctggga
gaaaaactcagcaaagacccaaatattgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcaaaggttttcctaccatctacttctcaccagccaaccag
aagctaaatccaaagaaatatgaaggtggccgtgaattaaatgattttgttagctatcta
caaaaagaagctacaaaccctcctataattcaagaagaaaaacccaagaagaagaagaag
gcgcaagaggacctctaa

DBGET integrated database retrieval system