KEGG   Meriones unguiculatus (Mongolian gerbil): 110556547
Entry
110556547         CDS       T05884                                 

Gene name
Sufu
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun05200  Pathways in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110556547 (Sufu)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110556547 (Sufu)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110556547 (Sufu)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 110556547
NCBI-ProteinID: XP_021506057
LinkDB
Position
Unknown
AA seq 485 aa
MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICLGTQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTHDRPPSRKDSLGSDSSSAVIPRE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVF
DSPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggagctgcggcctagcgtcgcccccggccccgccgcgcccccagcctctggccct
agtgctcctccggcctttgcctcgctctttcccccgggactgcacgccatctacggagag
tgccgccgcctttaccctgaccagccgaacccgctccaggttaccgctatcgtcaagtac
tggctgggtggtccagaccccttggattacgttagcatgtacaggaatatggggagtcct
tccgccaacatccctgagcactggcactacatcagctttggcctgagcgatctctatggt
gacaacagagtccatgagtttacaggaacagacggaccaagtggttttggctttgaattg
acatttcgcctgaagagagaaactggggagtctgccccaccaacatggcccgcagagctg
atgcagggcctggcccgatacgtcttccagtcagagaacaccttctgtagcggggaccac
gtgtcttggcacagccctttggataacagtgaatcgagaattcagcacatgctgctgaca
gaggacccccagatgcagcctgtgcggacgccctttggggtagttactttcctccagatt
gttggcgtctgcactgaggagctccactcagcccagcagtggaatgggcagggcatcctg
gaactgctgaggacagtgcctgttgctggcggtccctggctgataactgacatgcggagg
ggagagaccatatttgagatcgacccgcatctgcaacaggagagagttgacaaaggcatc
gagacagatggttccaacctgagtggtgtcagtgccaagtgtgcctgggatgacctgagc
cggcctccggaggatgatgaggacagccggagcatctgcctcggcacacagccccggagg
ctctctggcaaagacacagaacagatccgggagaccctgaggcgaggacttgagatcaac
agcaaacctgtccttccaccaattaactctcagcgacaaaatggcctcacccacgaccgg
cccccgagccgcaaggacagcttgggaagcgacagctcctcggccgttatcccccgtgag
ctgatccgcacacggcagctggagagcgtgcacctgaagtttaaccaggagtcaggggcc
ctcatccctctctgcctaaggggcagactcctgcatggccggcactttacctacaagagt
atcacaggtgacatggccatcacgtttgtgtccacgggagtggaaggcgcctttgccaca
gaggagcacccttatgcagctcacggaccctggttgcaaattctgttgacagaagagttt
gtagaaaagatgttggaggacttagaagatctgacttctccagaagaatttaaacttccc
aaagagtacagctggcctgaaaagaagctcaaagtgtccatcctccccgacgtggtgttc
gacagtccactgcactag

DBGET integrated database retrieval system