KEGG   Meriones unguiculatus (Mongolian gerbil): 110562937Help
Entry
110562937         CDS       T05884                                 

Gene name
Lig1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03030  DNA replication
mun03410  Base excision repair
mun03420  Nucleotide excision repair
mun03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110562937 (Lig1)
   03410 Base excision repair
    110562937 (Lig1)
   03420 Nucleotide excision repair
    110562937 (Lig1)
   03430 Mismatch repair
    110562937 (Lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mun03032]
    110562937 (Lig1)
   03400 DNA repair and recombination proteins [BR:mun03400]
    110562937 (Lig1)
Enzymes [BR:mun01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110562937 (Lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     110562937 (Lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110562937 (Lig1)
DNA replication proteins [BR:mun03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110562937 (Lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110562937 (Lig1)
DNA repair and recombination proteins [BR:mun03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110562937 (Lig1)
   NER (nucleotide excision repair)
    Other NER factors
     110562937 (Lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     110562937 (Lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 110562937
NCBI-ProteinID: XP_021515525
LinkDB All DBs
Position
Unknown
AA seq 911 aa AA seqDB search
MREAWRVKNQVQQMRKKEQERKGENSAATMQRSIMSFFQPTKEGKAKKPEKETPGNIREK
GPPPKVALKERNRVVPESDSPVKRPGRKAAQVLSSEGEEEEETPGTPKVQKPVSDSKQST
PPSPDTSPENSPFFTSSPSLDFSPSGFPKRRTARKQLPKRTVQDTPEEQDEDKDRAAKKR
KKEEESVTLTKTENIPTCKAGVKQEPQEEKQSKPPARAAKTLSSFFTPRKAAVKAEVKQE
ESSTPRKEETKGTLDPTSYNPSKNNYHPIEDACWEHGQKVPFLAVARTFEKIEEVSARLK
MIETLSNLLRSVVALSPPDLLPVLYLSLNCLGPPQQGLELGIGDGVLLKAVAQATGRHLE
SIRAEVAEKGDVGLVAENSRSTQRLMISPPPLTTSGVFTKFCDIAQLTGSASMTKKMDII
KGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVDAGKGK
TADARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPDHCKLSPGVPLKPMLAHP
TRGVSEVLKRFEEVDFTCEYKYDGQRAQIHLLEGGEVKIFSRNQEDNTGKYPDIISRIPK
IKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIFLNG
ESLARQPLSRRRQLLWENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTL
DVDATYEIAKRSHNWLKLKKDYLDGIGDTLDLVVIGAYLGRGKRAGRYGGFLLAVYDEES
EELQAICKLGTGFSDEELEEHHQSLQALVLPTPRPYVRIDGAVAPDHWLDPSVVWEVKCA
DLSLSPIYPAARGLVDKEKGISLRFPRFIHVREDKQPEQATTSDQVACLYRKQSQIQNQQ
NSDLDSDFEDC
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcttggcgtgtcaagaaccaggtacaacagatgagaaaaaaagaacaagag
aggaaaggggagaattctgctgctaccatgcagagaagcattatgtcattttttcagccc
acaaaagagggtaaagcgaagaaacccgagaaggagacacccggaaacatcagagagaag
ggaccccctccaaaggtggcattgaaggagaggaatcgagtggtacctgagagtgattct
ccagtgaagaggccaggaaggaaggcagcccaagtcctgagcagtgaaggggaagaggaa
gaagaaacccctggcacccctaaagtccagaagcctgtgtcagactccaaacagagtact
cctcccagccctgacacaagtcctgagaacagcccttttttcaccagcagcccttcactg
gacttctccccgtcaggattcccaaagcgtcgcactgctcggaagcagctcccgaagcgg
acagttcaagacactccggaggagcaggatgaggacaaagatagagcagccaagaaaagg
aagaaggaagaagagtcagtaaccctgacaaagacagagaacattccaacgtgtaaggcc
ggagtgaaacaggagcctcaggaagagaagcagagcaagcctcctgccagagctgccaag
acactcagcagcttcttcactccccggaaggcagcagtgaaagctgaagtgaaacaagaa
gagtcaagtactccaagaaaggaagagaccaagggaaccctggatccaacaagttataat
ccttccaagaataactaccatcccattgaagatgcctgctgggaacacggccagaaggtc
ccttttctcgctgtggcccggacatttgagaagattgaggaggtttctgctcggctcaag
atgatagagacactaagcaacctgctacgctctgtggtggcactatcacctccagacctg
ctccctgtcctctacctcagcctcaactgccttgggccacctcaacaaggactagagctg
ggcattggtgacggtgttcttctcaaggcagttgctcaggccacaggtcgtcatctggag
tccatccgggctgaggtggctgagaagggtgatgtggggctggtagctgagaacagtcgc
agcactcagagactcatgatatccccacctccactcaccacctctggagtctttaccaaa
ttctgcgacattgcccagctcactggcagtgcttctatgaccaagaagatggacatcatc
aagggcctttttgttgcctgccgccactcagaagcccggttcattgccaggtccctaagt
gggcggctgcgccttgggctggctgagcagtcggtgctggctgcgcttgcccaagctgtg
agccttacaccccctggccaagaatttcccccagccgtggtggatgctgggaagggcaag
acagcagacgccagaaagatgtggttggaagaacaaggaatgatcttgaagcaaaccttc
tgtgaggtgcctgacctggaccgaatcatccctgtgctgctggaacatggcctggaacgt
ctcccagaccactgcaaactgagcccaggggtccctcttaaaccaatgctggcccatccc
actcggggtgtcagtgaggtactgaaacgcttcgaggaggtagatttcacctgcgagtat
aaatacgatggacaacgggcacagatccaccttctggaaggaggagaggtgaagattttc
agcaggaaccaggaggacaacacaggaaaatatcctgacatcatcagccgcattcccaag
ataaaactcccctcagtcacatctttcattttggacactgaggcagtggcctgggaccgg
gaaaagaagcagatccagccattccaagtgctcaccacacgcaagcgcaaggaggttgac
gcatcagagatacaggtgcaggtgtgtctgtatgcctttgacctcatcttcctcaatgga
gagtccctggctcgccagcccctgtctcgacgccggcagctgctgtgggagaactttgtg
gagacagagggtgagtttgtctttgccacctccttggataccaaggacattgagcagatt
gctgaattcttggagcagtcagtgaaggactcctgtgagggcttgatggtgaagaccctg
gatgttgatgccacatatgagattgctaagaggtcacacaactggctcaagctgaagaag
gactaccttgatggcattggcgacactctggaccttgtggtgattggcgcttacctgggc
cggggaaagcgggctggccgatatgggggcttcctgctggctgtctatgatgaggagagt
gaagagctgcaggccatatgtaagctgggaaccggattcagtgatgaggaactggaggag
catcaccagagccttcaggccctggtattgcccactccacgtccgtatgtgaggattgat
ggggcagtggccccagaccactggctagacccaagcgttgtatgggaggtgaagtgtgct
gatctctccctgtcccccatctaccctgctgcacggggattggtggacaaagagaaaggg
atctcccttcgttttcctcggttcattcatgttcgtgaagacaagcagccagagcaggcc
actaccagtgaccaggtggcctgtttgtaccggaaacagagtcagattcagaaccagcaa
aactcagacttggactccgactttgaagactgttaa

DBGET integrated database retrieval system