KEGG   Meriones unguiculatus (Mongolian gerbil): 110563913
Entry
110563913         CDS       T05884                                 

Gene name
Megf8
Definition
(RefSeq) multiple epidermal growth factor-like domains protein 8
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110563913 (Megf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mun04990]
    110563913 (Megf8)
Domain-containing proteins not elsewhere classified [BR:mun04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   110563913 (Megf8)
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_5 Kelch_6 Kelch_1 CUB EGF_CA EGF_3 Laminin_EGF PSI PSI_integrin EGF_2 FXa_inhibition EGF
Other DBs
NCBI-GeneID: 110563913
NCBI-ProteinID: XP_021516823
LinkDB
Position
Unknown
AA seq 2784 aa
MALGGALAAALALALAVLGPWSLRVLAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPQGPLLASLSGSTRPPPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCRNHGQCKSPGVCVCEPGWGGPDCGLQECSAYCGS
HGTCISPLGPCRCEPGFLGRACDLHLWENQGAGWWHAVSAGDPAFSARIGAAGAFLAPPG
LLAVFGGQDLNKALGDLVLYNFSTNTWESWDLSPAPAARHSHVAVAWAGSLVLMGGELAN
GSLTNDVWAFSPLGGGHWELLAPPAPSSSGPPGLAGHAAALVDDTWLYVSGGRTQRDLFS
SGLFRFRLDRSSRGYWEQVIPAGGRPPAATGHSMVFHAPSRTLLVHGGHRPSTARFSVRV
NSTELFHVDRRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGRAAPPRGRYSHVAAVLGGSVLLVAGGYSGRPRGDL
MAYKVPPFVFQAPALDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPSGACPAA
SCLGLGRLLSDCQACLAFSSPAAPPRGPGALGWCVHNESCLPRPEQARCRGEQISGTVGW
WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNASQPDKVSIVRSTTITLTPSPETDVSL
VYRGFIHPLLPGGPGGPGADDVAVWARAQRLHVLARMARGPDTENMEEVGRWVAQQEKET
RRLQRPGSERLFPVPGRGHKYAVEICGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFL
EPYRSSACASYSSCLGCLADQGCGWCLNSATCHLRQGRAHCEDDGAGESLLVLVPALCPL
CEEHRDCHACTQDPFCEWHQSTNRKGDAACSRRGRGRGALKSPEECPSLCSQRLTCEDCL
ANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCAGFLTCHECLQSHE
CGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPGALPARWAYARCPDVDECRL
GLARCHPRATCLNTPLSYECRCQRGYQGDGVTHCNRTCLEDCGHGVCSGPPDFTCVCDLG
WTSDLPLPTPAPGPPTPRCSRDCGCNFHSHCHRRGPGFCDECQDWTWGEHCERCRPGSFG
NATGSGGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQICSPGYYGDPRAGGSCF
RECGGRALLTNVSSVALGSRRFGGLLPPGGGAARAGPGLSYCVWVVSATEELQPCAPGTL
CPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQAL
SGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWA
GPHCRMALCPENCNAHSGAGICNQSLGVCVCAEGFGGPDCATRLDGGQLVWETLMDSRLS
ADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGG
PGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKAPQNMELPAV
AGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYH
EATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDT
MVVLGGRSDPDEFSSDVLLYQVNCNTWLLPDLTRPALVGSPVEESVAHAVAAVGGRLYVS
GGFGGVALGRLLALTLPPDPCRLLPSPEACNQSGACSWCHGACLSGDQAHRLGCGVPPCS
PMPRLPEECRRLRTCSECLARHPRTLQPGDGEAAPPRCKWCTNCPEGACIGRNGSCTSEN
DCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTC
FSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLASKGADGGWQHCVWSSSLQQCLSPS
YLPLRCMAGGCGRLLRGPESCSLGCAQATQCALCLRRPQCGWCAWGGQDGGGRCVEGGLS
GPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCRDQPHGYECSCKTGYTMDNVT
GVCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNH
TKGSHCEQCLPLFVGSALGGGTCRPCHAFCRGNSLTCVSRKELEMARKEPEKYSLDPEQI
ESWVTEGPSEDEAVCVNCQNNSYGDKCESCLHGYFLLDGKCTKCQCNGHADTCNEQDGTG
CPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPT
SQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVA
PDTGVHTVHIQPPPPPPPPPPPPADGGPRAAELGAPGTGGAAGAAEPRVREVWPRGLITY
VTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPGAPGANGSADSQGLL
FFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRPF
AKVTVCFPPDPGPAPAWKPAGLPPPAFRRSEPFLTPLLLTGAGGPWGPLGGGCCPPALPA
PAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYGGGGGG
GGGHGGGGGRKGLLSQDNLTSMSL
NT seq 8355 nt   +upstreamnt  +downstreamnt
atggccttgggcggggctctggccgcggccctggcgctggccttggcagtgctggggccc
tggtcgctcagggtcctggcgggtgactgcaaggggcagcggcaggtgctgcgggaggcg
ccaggcttcgtgacggacggtgcgggcaactacagcgtcaatggcaactgcgagtggctt
atcgaggccccgagccctcagcaccgaatcctgctggacttcctcttcctggacaccgag
tgcacctacgactacctgtttgtgtatgacggtgactcgccccagggccccctgctcgcc
agtctgagcgggagcacccggcccccgcccatcgaggcttcctcaggcaagatgctgctc
cacctcttcagcgatgccaactacaacctgctgggctttaacgcgtccttccgcttctcc
ctgtgtccgggaggctgccggaaccacgggcagtgcaagtccccgggcgtgtgcgtctgt
gagccgggctggggagggccagactgcggcctgcaggagtgctcagcctactgtggcagc
cacggcacctgcatctcgcccctgggaccatgccgctgcgagcccggcttcctgggccga
gcctgtgacctgcacctgtgggagaaccagggggccggctggtggcacgccgtgagcgcc
ggggaccccgccttctctgcccgcatcggggccgccggcgccttcctggccccgccaggg
ctgctggctgtctttggaggccaggacctcaacaaggcccttggtgaccttgtcctgtac
aacttctccaccaacacctgggagtcctgggacctgagtcctgctccggctgcccgtcac
tcccacgtggccgtggcctgggccggctccctggtgctgatggggggggagctggccaac
ggctcgctcaccaacgatgtgtgggccttcagccccctgggcggaggccactgggagctc
ctggccccgcctgcccccagttcctccgggccgccgggcctggcaggccacgccgccgct
ctggtggacgacacctggctgtacgtgtctggcggtcgcacacagcgtgaccttttttcc
tccggccttttccgcttccgcctggaccgcagcagcaggggctactgggagcaggtgatc
ccggcgggtggacggcccccagctgccactggccactccatggtgttccacgccccctcc
cgtaccctgctggtccacggtgggcaccggccttccactgcgcggttttccgtgcgggtg
aactccaccgagctcttccacgtggatcggcgcgtgtggaccacgctcaagggccgggat
gggctccagggtccccgggagcgagccttccacacggccagtgttctgggaaactacatg
gtggtctatgggggcaatgtgcacacccattaccaggaggaaaagtgctatgaagatggc
atcttcttctaccaccttgggtgccaccagtgggtgtcaggggcggagcttgccccacca
ggaacccctgagggccgggcagcgcctccgcgaggtcgctactcccacgtggcggctgtt
cttggcggcagcgtcctgctggtggccggggggtacagcggccggcctcgcggggacctc
atggcctacaaggtgccacccttcgtgtttcaggcaccggccctggattaccacctggac
tattgctccatgtacacggaccacagtgtctgctcccgagacccggaatgtagctggtgt
cagggggcctgccaggctgcaccccctcccgggaccccctcaggagcctgtccagcggcc
agctgcctgggcctcggccgcctgctgagcgactgccaggcgtgcctggccttcagtagc
cccgcagccccgccccggggacccggcgccctagggtggtgtgtgcacaatgagagctgc
cttcctcggcctgagcaggcccgctgccgaggggagcagatctccggcaccgtgggctgg
tgggggccggcgcctgtctttgtcacctccctggaggcctgcgtcacccagagcttcctg
cctggcctgcacctgctgaccttccagcagccacccaacgcctctcagcctgacaaggtg
tccattgtccggagtaccacgatcaccctgacccccagcccggaaacagacgtgtccctg
gtctaccgcgggttcatccacccgctgctgcccggagggccaggcggccccggcgctgac
gatgtggccgtgtgggctcgggcccagcgccttcatgtcttggcccggatggccagaggc
cctgacactgagaacatggaggaggtggggcgctgggtggcccagcaggagaaggagacg
cggcgcctgcagcgccctggctctgaacgcctcttcccagtgcccgggagaggccacaag
tatgcggtggagatctgcggccagctcaacggctctgcaggccccgggcatagcgagctc
acgctcctgtgggatcgcactggagtgccgggcggcagtgaaatctccttcttcttcctg
gagccctaccggtcttcggcctgcgcctcctactcctcctgcctgggctgcctggctgat
cagggctgtggctggtgcctgaacagtgccacctgccaccttcgtcagggccgcgcgcac
tgtgaggatgatggggccggagagtccctgctggtgctggtgcccgccctctgtccactc
tgtgaggagcaccgtgactgccatgcctgcacccaggaccccttttgtgagtggcatcag
agcaccaaccgcaaaggggacgcggcgtgcagccggcgaggccggggtcgaggcgctctg
aagagcccggaggaatgcccttcgctctgcagccaacgcctgacctgtgaggattgcctg
gccaactccagccagtgtgcctggtgccagtccacgcacacctgcttcctgttcgctgcc
tacctggcccggtacccgcacgggggctgccggggctgggacgacagtgtgcattcggag
ccaaggtgcaggagctgcgccggcttcctcacgtgccacgagtgtctgcagagccacgag
tgtggctggtgtggcaacgaggacaaccccactctgggacggtgcctacaaggagacttc
tctggacccctgggtggggggaactgctccctgtgggtgggagagggcctggggctgcct
ggggctctccctgcccgctgggcttatgcccgctgtccagacgtggacgaatgtcgcctt
ggcctggcgaggtgtcacccccgtgcaacctgcctgaacacgcctctcagctacgaatgt
cgctgccagcgtggctaccagggcgacggcgtcacacactgtaaccgcacgtgcctggaa
gactgtggccatggcgtgtgcagcggtccaccggacttcacctgtgtgtgcgacctgggc
tggacctcagatctgcccctgcccacccctgccccgggaccccccaccccccgctgctct
cgagactgcggctgcaacttccacagccactgccacaggcgggggcctggcttctgtgac
gagtgtcaggactggacgtggggggagcactgtgaacggtgccggccgggcagctttggc
aacgcaacaggctctggtggctgccggccctgccagtgcaacgggcatggagaccctcgc
cgtggccactgtgacaacctcagtgggctctgcttctgccaggaccatactgagggtgcc
cactgtcagatttgctcaccaggatactacggggacccccgagctggcggctcctgcttc
cgggagtgtgggggccgcgccctcctcaccaacgtgtcctcggtggctctgggctcccgc
cgctttgggggacttttgcctccaggtggcggggcagcaagagcggggcctggcctgtcc
tactgcgtgtgggttgtctcagccacggaagagctgcagccctgtgctccggggaccctc
tgtcccccgctcaccctcaccttctctcccgacagcagcaccccctgcacactgagctac
gtcctggccttcgatggatttccgcgcttcctggacactggtgttgtccagtcagatcgg
agcctcatcgctgccttctgtggccagcggcgggacagacccctcaccgtgcaggctcta
tccgggttacttgtgttgcactgggaggccaacggctcctcgtcctggggcttcaatgct
tcggtgggctccgcccgatgtggatcagggggtcctggcagctgccctgtcccccaggag
tgtgtgccccaggatggggcggcaggtgctggcctctgccgctgtcctcagggctgggct
ggccctcactgccgcatggctctgtgtcctgagaactgcaatgcccacagtggggcgggg
atctgtaaccagagcctcggtgtgtgcgtctgtgctgagggcttcggtggcccagactgc
gccacaaggctggacggtgggcagctggtgtgggagacgctcatggacagccgcctctca
gctgacactgctagtcgcttcctgcaccgcctgggtcacaccatggtagaggggcctgac
gccaccttgtggatgtttgggggcctgggcctgccccagggcctgctgggaaacctgtac
aggtattcagtcagtgagcgcaggtggacacagatgctggcaggagctgaggatgggggc
ccaggcccgtcaccccgctccttccacgcagctgcctacgtgcctgctggccggggggcc
atgtacctgctggggggcctcacagctggaggcgtcacccgggacttctgggtgctcaac
ctcactaccctgcagtggcgacaggagaaggcccctcagaacatggagttgccagccgtt
gctggccacaccctaactgcccggcgaggcctatctctgctcctggtggggggctactcc
ccagaaaatggcttcaaccagcagttgttggagtaccagctggcgactggcacctgggtg
tctggagcccagagtgggacacccccaacaggtctctatggtcattctgcggtctaccac
gaggccacagactccctctacgtgtttggcggtttccgcttccatgtggagctggcggcg
ccctccccagagctctactccctgcactgccctgaccgcacctggagcttgctggctcct
tctcagggggcaaagccccggccccgccttttccatgcttcagctctgctgggagacacc
atggtggtcctcgggggccgctcagaccctgatgagttcagcagtgacgttctgctctac
caggtcaactgtaacacctggctgctgccggacctcacccgtccagcccttgtggggtcc
ccagtggaggagtctgtggcccatgcagtggccgcagtgggtggccgcctgtacgtctcc
ggaggatttggaggagtggccttgggccgcctgctggcattgaccctgccccctgacccc
tgccgtctattgccttcacctgaagcctgtaaccagtctggggcctgcagctggtgccat
ggtgcttgcctgtctggagaccaggcccacaggctgggctgtggggtgcccccgtgctcc
ccgatgcctcgcttgcccgaggagtgccggaggctgcggacctgcagcgagtgcctggcc
cgacaccctcggaccctgcagcctggggacggggaggcagcccctccccgctgtaagtgg
tgcaccaactgcccagagggggcctgcatcgggcgcaacggctcctgcacgtcagagaac
gactgtcggatcaaccagcgcgaggtcttctgggccgggaactgctcggaggctgcgtgc
ggggccgccgactgtgagcagtgcacgcgcgagggcaagtgcatgtggacgcggcagttc
aagaggacgggggagacgcgccggatcctgtcggtgcagcccacgtacgactggacctgc
ttcagccactccctgctgaacgtgtctcccatgccggtcgagtcgtcgcctccgctgccc
tgccccacgccctgccacctcctccccaactgcacgtcctgcctggcgtccaagggcgcg
gatgggggctggcagcactgtgtgtggagcagcagccttcagcagtgtctgagcccttct
tacctgcccttgcggtgcatggctggaggctgtgggcggctgctcaggggccccgagagc
tgctccctgggctgtgctcaggccacacagtgtgccctgtgcctacggcgcccccagtgc
ggctggtgtgcctggggcggccaggacgggggtggccgctgcgtggaaggtggcctcagt
ggcccccgagacgggctgacatgtggacgccctggggcatcctgggccttcctgtcctgc
ccccctgaggatgagtgtgcaaacgggcaccatgactgcaatgagactcagaactgccgc
gaccagccccacggctatgagtgcagctgcaagacgggctacaccatggacaatgtgact
ggtgtgtgccgccctgtgtgtgcgcagggctgtgtgaacggctcctgcgtggagcccgat
cactgccggtgtcacttcggctttgttggccgcaactgctccacagagtgtcgctgcaac
cgccacagcgagtgtgcaggcgttggtgcccgggaccactgcctgctgtgccggaaccac
accaagggtagccactgtgagcagtgtcttccgctgtttgtgggttcagctttggggggc
ggaacctgccggccctgccatgccttctgccgagggaacagcctcacgtgtgtctccagg
aaagagctcgaaatggccaggaaggagccagagaagtactcactggatccagagcagatt
gaaagctgggtgacagaagggcctagtgaagatgaagccgtgtgtgtcaactgccagaat
aacagctatggggacaagtgtgagagctgcctccacggctacttcctcctggacgggaag
tgcaccaagtgccagtgtaacggccacgctgacacctgtaatgagcaggacgggacaggc
tgcccgtgccagaacaacacggagacgggtacctgccagggcagctcccccagtgaccgc
cgagactgctacaagtaccagtgcgccaagtgccgcgagtccttccacgggagccccctg
gggggccagcagtgttaccgcctcatctcggtggagcaggagtgctgcctggaccccacc
tcccagaccaactgcttccacgagcccaagcgccgggcgctggggccgggccgcaccgtg
ctcttcggcgtgcagcccaagttcaccaacgtggacatccgcctgacgctggacgtgacc
ttcggcgccgtggacctgtatgtctccacctcctatgacaccttcgtggtgcgcgtggcc
cccgacacgggcgtccacacggtgcacatccagccgccgcccccgccgccgccgccgccc
ccgcccccggcggacggggggccccgggccgccgagctgggggccccagggaccgggggc
gcggcgggagccgccgagccgcgcgtgcgcgaggtgtggccgcggggcctgatcacctac
gtgacggtgacggagccatcggccgtgctggtggtgcgcggcgtgcgcgaccggctggtg
atcacctacccccacgagcaccacgccctcaagtccagccgcttctacctgctgctgctg
ggcgtgggcgaccccggcgcgcccggcgccaacggctcggccgactcgcagggcctgctc
ttcttccggcaggaccaggcgcacatcgacctgttcgtcttcttctccgtgttcttctcc
tgcttcttcctcttcctctccctctgtgtgctcctctggaaggccaagcaggccctggac
cagcggcaggagcagcggcggcacctgcaggagatgaccaagatggccagccgccccttt
gccaaggtcacggtctgcttccccccggacccgggccccgcgcctgcctggaagcccgcg
gggctcccgccgcccgccttccgccgctccgagcccttcctcacgccgctgctgctgacg
ggcgccgggggcccctgggggcccctggggggcggctgctgcccgcccgcgctcccggcc
cccgccggcctgcgcgccgggcccatcaccctggagcccacggaggacggcatggcgggc
gtggccacgctgctgctgcagctgcccggcggcccccacgcacccaacggggcctgcctc
ggctcagccctcgtcacgctgcgccacaggctgcacgagtacggcgggggcggcggcggc
ggcggcgggcacggcgggggcggcggccggaaggggctgctgagccaggacaacctcacc
agcatgtccctttga

DBGET integrated database retrieval system