KEGG   Meriones unguiculatus (Mongolian gerbil): 110563960
Entry
110563960         CDS       T05884                                 

Gene name
Ptgdr
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110563960 (Ptgdr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mun04030]
    110563960 (Ptgdr)
G protein-coupled receptors [BR:mun04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    110563960 (Ptgdr)
SSDB
Motif
Pfam: 7tm_1 MraY_sig1 PhoR
Other DBs
NCBI-GeneID: 110563960
NCBI-ProteinID: XP_021516897
LinkDB
Position
Unknown
AA seq 356 aa
MNESYRCHAFTWVEMGSSPTMGGVLFGAGLLGNLLALVLLARSGLGSGRQRPLRPPSVFY
VLVCGLTVTDLLGKCLISPVVLASYAQNRSLQELLPFRGNQLCQGFAFIMSFFGLASTLQ
LLAMALECWLSLGHPFFYQRHITLRRGALVAPVVGAFCLALCSLPFAGFGKFVQYCPGTW
CFIQMVHKKRSLSVVGFSVLYASLMALLVLATVLCNLGAMHNLYAMHRRLWHYPRCCPRD
RAQPASGYRHGSLHPLEELDHLVLLALMTVLFTMCSLPLIYRAYYGAFQLVSTAEGDSED
LQALRFLSVISIVDPWIFIIFRTSVFRMLFHKIFIRPLIYRNWHSHSCQTNRESTL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgaatgagtcctatcgctgccacgctttcacatgggtggaaatgggctcctcgccgacg
atgggcggtgtgctcttcggcgccgggctgctgggcaacctgctggcgctcgtgctgctg
gcacgctccgggctggggtccggccggcagagaccactgcgcccgccctcggtcttctac
gtgctcgtgtgtggcttgactgtcaccgacttgctgggcaagtgcctgatcagccccgtg
gtcctggcttcctacgcgcaaaaccggagcctacaggaactgctgccgttccggggcaat
cagttatgtcaaggcttcgccttcatcatgtccttctttgggctagcctcgacgttacag
ctgctggctatggctctggagtgctggctgtctctgggacacccgttcttctaccaaagg
cacatcaccctgcgccggggagcgctggtggcgccggtcgtgggcgccttctgcttggct
ctctgctcgctccccttcgctggctttgggaagtttgtgcagtactgtcctggcacctgg
tgcttcatccagatggtccacaagaagcgctcgctttcggtagttggcttctctgtgctc
tacgccagcctcatggcgctgctggtcctcgcgaccgtgctgtgcaacctaggtgccatg
cacaacctctatgccatgcaccggcgcctgtggcactaccctcgctgctgccccagggac
cgcgcccagccggcctccggttataggcacgggtccctgcatcccctggaggagctggac
cacctcgtgctgctggctctcatgaccgtgctcttcaccatgtgttccctgcctttaatt
tatcgtgcttactatggagcctttcaacttgtcagcacagctgaaggagattcagaagac
ctccaagccttgcgttttctgtctgtgatttcaatcgtagacccctggattttcatcatt
ttcaggacttcagtattccggatgttattccacaagattttcataagacctctgatctac
agaaactggcacagccattcctgccaaactaacagggaatccactttatga

DBGET integrated database retrieval system