KEGG   Musa acuminata (wild Malaysian banana): 103970769Help
Entry
103970769         CDS       T03447                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00220  Arginine biosynthesis
mus00250  Alanine, aspartate and glutamate metabolism
mus00710  Carbon fixation in photosynthetic organisms
mus01100  Metabolic pathways
mus01200  Carbon metabolism
mus01210  2-Oxocarboxylic acid metabolism
mus01230  Biosynthesis of amino acids
Module
mus_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103970769
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103970769
   00220 Arginine biosynthesis
    103970769
Enzymes [BR:mus01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     103970769
Amino acid related enzymes [BR:mus01007]
 Aminotransferase (transaminase)
  Class I
   103970769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 103970769
NCBI-ProteinID: XP_009382959
LinkDB All DBs
Position
11
AA seq 522 aa AA seqDB search
MRRFATERAKRLLFGSLLASRSPPSAFLCSSPPAAAAMDPAAGVVTVDTINPKVLKCEYA
VRGEIVSHAQRLQQELQDKPGSHPFDEILYCNIGNPQSLGQQPVTFFREVLALCDHPSLL
DKSETHALFSADAIARAWQILDVIPGRATGAYSHSQGIKGLRDAIAAGIADRDGFPANPD
DIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSASIALHGGSLVPYYLDESTGWG
LEISELKKQLEDARSKGITVRALVVINPGNPTGQVLAEENQREIVNFCKNEGLVLLADEV
YQENIYVDDKKFNSFKKITRSMGYIDDEIPLVSFQSVSKGYYGECGKRGGYMEVTGFNAQ
VREQIYKVASVNLCSNISGQILASLVMNPPKVGDESYESFNADKNGILSSLARRAKALED
AFNSLEGVSCNKAEGAMYLFPRLRLPQKAIAAAKAVNAAPDAFYARRLLDATGIVVVPGS
GFGQVPGTWHVRCTILPQEDKIPAIISRLKAFHEAFMEEFRD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgatttgccacggagagagcgaaaaggctgctctttggttcgctcctcgcctcg
cggtctccgccttctgctttcctctgttcttcaccccccgccgccgccgccatggatccc
gctgctggtgttgtcactgtcgacacgatcaacccaaaggttttaaaatgtgagtatgct
gttcgtggtgaaattgttagccatgcgcagcgcttacaacaggagctgcaagacaaacca
gggtcccatcccttcgatgagatactgtactgcaatattgggaatcctcagtctcttggt
cagcagcctgttacctttttccgtgaggttcttgcgctgtgtgaccatccatctcttttg
gacaaaagtgaaactcacgccttgttcagtgctgatgcaatagcaagagcatggcagatt
ttagatgtgattcctggaagggctacaggagcatatagccatagtcagggtatcaaaggt
ttacgagatgcaattgctgctggaattgctgatcgggatggttttcctgccaatccagat
gatattttcctaacagatggagcaagtcctgcggtgcacatgatgatgcagttgttaata
agatctgagaaagacggcattttgtgccccattcctcagtaccctttgtattctgcttcc
attgcccttcatggtggctctcttgttccgtattaccttgatgaatcaacaggatgggga
ttggagatttcagagcttaagaaacaactcgaagatgctcgatccaaggggatcacagtg
agggcattagtcgtgataaatccaggcaatcccaccggacaggttcttgcagaggaaaac
caaagggagatagtcaacttttgcaagaatgaagggctggtccttctggcagacgaggta
tatcaagaaaatatatatgtcgatgataagaaattcaactctttcaagaagatcacaaga
tccatgggatatatcgatgatgagatccctttggtatcatttcaatctgtttctaaaggt
tactatggagaatgcggaaaaaggggcgggtacatggaggtcactggctttaatgcccaa
gtgagagaacaaatctacaaggtggcatccgtaaacctttgctccaacatctccggccaa
atccttgccagtcttgttatgaatccaccaaaggtcggagacgaatcatatgaatctttc
aatgcagataaaaatgggattctttcgtctctagctagacgtgccaaggcattggaagat
gcattcaacagcttagagggcgtgagctgcaacaaagcagagggcgcaatgtatctcttt
cctcgcctgcgcctaccacagaaggctatcgcagctgccaaagcagttaatgcagcacca
gatgcattctacgctcgacgtcttctcgatgccaccggcatcgtcgtcgttcctggatct
ggctttgggcaggttcctggaacatggcacgtcagatgcacgatcctgccgcaggaggac
aaaatccccgccatcatatcccggctcaaggcgttccatgaagctttcatggaggagttc
cgtgactga

DBGET integrated database retrieval system