KEGG   Musa acuminata (wild Malaysian banana): 103976989Help
Entry
103976989         CDS       T03447                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03030  DNA replication
mus03410  Base excision repair
mus03420  Nucleotide excision repair
mus03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103976989
   03410 Base excision repair
    103976989
   03420 Nucleotide excision repair
    103976989
   03430 Mismatch repair
    103976989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mus03032]
    103976989
   03400 DNA repair and recombination proteins [BR:mus03400]
    103976989
Enzymes [BR:mus01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103976989
    6.5.1.6  DNA ligase (ATP or NAD+)
     103976989
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103976989
DNA replication proteins [BR:mus03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103976989
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103976989
DNA repair and recombination proteins [BR:mus03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103976989
   NER (nucleotide excision repair)
    Other NER factors
     103976989
   MMR (mismatch exicision repair)
    Other MMR factors
     103976989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF5562 HTH_36 TrmB
Motif
Other DBs
NCBI-GeneID: 103976989
NCBI-ProteinID: XP_009390651
LinkDB All DBs
Position
1
AA seq 750 aa AA seqDB search
MLLLRAPFLLSLKFPPLRPCFPSLPFSNPWSRNLFLRCCSTGRAAMSGRRTVADVLMGNA
RAAAAAAAKSKKSAPSSAQPEQPSPSPSKKPKTLDGGGQNPKDPPEEKNPTLDLKKKCSD
FNPKKAASWKDGEPVPFLFLARALELISNESGRIAITEIICNVFRTVIATTPGDLLATVY
LSANRIAAPHEGIELGIGDASLVKALAEAYGRKEEQVKKQLKELGDLGLVAKASRSSQKV
MFKPQPLTIAKVFDTFRAIAKESGKDSQDKKRNHIKGLLVAATECEPQYLVRLLQSKMRI
GLAEKTVLVALGQAAIYSETNQNPRSQTQSDLEEAAKIIKQVYSVLPIYDKIVPELLHVG
VWKLPEACNFSLGVPVGPMLAKPTKAVSEILDKFQGMEFTCEYKYDGERAQIHYMEDGSV
EIYSRNAERNTGKYPDVVGSVSRFKKPAVKSFVLDCEIVAYDREKQRILPFQILSTRARK
GVILSDIKVAVCTFAFDILYVNGQPLLQEQLKVRREHLYGSFEEVPGVFQFATAITSDDL
EEIQKFLDTAVNTSCEGLIIKTLDKDATYEPSKRSNNWLKLKKDYMESIGDSLDLVPIAA
FHGRGKRTGVYGSFLLACYDEHNEEYQSICNIGTGFSESQLEERSTSLRNKIIPKPKPYY
RFSDTMDPDVWFEPSEVWEVKAADLSISPVHRAANGIVDPNKGISLRFPRLLHVRDDKSP
EEATTSEQVAEMYRAQKINHTNNQDEDDDD
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgctgcgagcgccgtttctcctgtcgctcaaattccctccactgcgtccctgc
ttcccatctctccccttctcaaacccttggtcaagaaacctcttccttcgctgctgcagc
accggccgtgccgcaatgtcgggccgccgcaccgtcgccgacgttctcatgggcaacgcc
cgcgccgcggccgcggccgcagccaaatccaagaagtccgccccatcctccgcccagccc
gaacagccttccccttccccttccaagaaaccgaaaaccctagatggcggtggccaaaac
cctaaagatcctcccgaggagaagaaccccaccctcgacctgaagaagaagtgctccgac
ttcaaccccaagaaagccgcttcgtggaaggacggggaacccgttcccttcttgttcctc
gcgcgcgcccttgagctaatctcgaacgagtccggaaggatcgccatcacggagattatc
tgcaacgtgttcaggaccgtgatcgctaccacgcccggggatcttctcgccaccgtttac
ctttcggcgaataggattgcggcgccccatgaaggtattgagcttgggattggggacgcg
tcccttgtgaaggcgcttgccgaggcttatgggaggaaggaggagcaagtcaagaagcag
ctaaaggaactgggtgacttgggtcttgttgcaaaagcaagccgttcctctcagaaagtg
atgttcaagcctcaacccttgacgattgccaaggtttttgatacattccgtgcaattgca
aaggagtcgggaaaagatagtcaagacaagaaaagaaatcacataaaaggacttcttgtt
gcagcaactgaatgtgaacctcagtatttagttcgtcttcttcagtcgaagatgcgaatt
ggtttggcagagaaaactgtcctggtagctctcggacaagcagctatttattctgaaacg
aatcaaaatccacggtcacaaactcagtctgatcttgaagaggctgcgaaaattatcaaa
caagtttattcggtactcccaatctatgataaaattgttcctgaacttctccacgttgga
gtatggaaacttccagaggcatgcaatttctccctaggtgtgcctgtagggcctatgtta
gctaaaccaacaaaggcagtgtctgaaattcttgataagtttcagggaatggaattcact
tgcgaatacaaatatgatggtgaacgagcccagatacattatatggaggatggatcagtt
gagatatatagtcgtaatgctgaaaggaacactgggaagtacccagatgtggtcggttct
gtatcaagattcaaaaaacctgctgtaaaatcatttgtgcttgattgtgaaattgttgct
tatgaccgtgagaagcaaaggatcttgcctttccagatattgagcactcgtgctcggaag
ggagtgatcttaagtgacataaaagtagctgtttgcacctttgcctttgacattctgtat
gtaaatggccaacctctacttcaggagcaactgaaagttcgtcgagagcacctttatggt
tcctttgaagaagtacctggagtctttcagtttgcaactgcaataacatcagatgatctc
gaggaaatacagaaattccttgacactgctgtcaacaccagttgcgaaggattgattatc
aagacattggataaggatgctacatatgagccttcaaagcggtcaaacaattggttgaag
ttgaagaaagattatatggaaagcattggtgattcacttgatttggttcctattgctgca
ttccatggtcggggaaagcggacaggtgtttatggctcatttcttcttgcttgctacgat
gaacataatgaagaatatcaaagcatctgtaacataggtactggtttctctgaatcacag
cttgaagaacgatcaacaagtcttcgtaataaaataattccaaagcctaagccatattat
cggttttcagatacaatggatccagatgtatggtttgagccatcagaggtttgggaggtt
aaagcagcagatttgagcatcagtcctgttcaccgtgctgctaatggtatagtcgatcca
aacaagggaatttcacttcgatttcctcgcttactacatgtccgtgatgacaaaagccct
gaagaagctacaacatctgagcaggttgctgaaatgtatcgtgctcagaagatcaaccac
acaaacaatcaagatgaggatgatgacgattaa

DBGET integrated database retrieval system