KEGG   Musa acuminata (wild Malaysian banana): 103984706Help
Entry
103984706         CDS       T03447                                 

Definition
(RefSeq) beta-galactosidase 8 isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00052  Galactose metabolism
mus00511  Other glycan degradation
mus00531  Glycosaminoglycan degradation
mus00600  Sphingolipid metabolism
mus00604  Glycosphingolipid biosynthesis - ganglio series
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103984706
  Lipid metabolism
   00600 Sphingolipid metabolism
    103984706
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    103984706
   00604 Glycosphingolipid biosynthesis - ganglio series
    103984706
   00511 Other glycan degradation
    103984706
Enzymes [BR:mus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     103984706
Exosome [BR:mus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103984706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 103984706
NCBI-ProteinID: XP_009400533
LinkDB All DBs
Position
5
AA seq 681 aa AA seqDB search
MASTTTVELLLLVLLFLLLTAAAPGFSSSPELSSSPRSFHRRHGSPFLGQAPNDRRFQIS
DDMFWKDDRPFRIIGGDVHYFRVLPQYWRDRLLRAKALGLNTIQTYVPWNLHEPEPNKWV
FEGIADIEAYLKLAQELGFLVMLRAGPYICAEWDLGGFPAWLLAIEPPLKLRSSDMTFLH
YVERWWAVFLPRIAPLLYQNGGPIIMVQVENEFGSYGDDKAYLHHLVTLARKHLGHDIIL
YTTDGGSRETLDKGTIPGEGVFSAVDFSTGEDPWPIFELQKKYNAPGQSPPLSAEFYTGW
LTHWGEQNTETDANRTAAALENILSRNGSAVLYMAHGGTNFGFYSGANTGQNESDYKADL
TSYDYDAPIKESGDVDNLKYKALRRVIQEYSGVVLSLPPPDNGKKGYGLVTVRKIASFFE
VLDGMINPRTAVESEQPMAMESVGQMFGFLLYVSELPIMGTSSILKIQKVHDRAQVFVSC
TMDKNGGSPRHVGVIERWSNRELVIPKVSCSSNISLFILVENLGRVNYGKYIFDRKGILS
NVTVDGAVILGWKMYPISLDICSKLFNVNPIKQVSISRTEKISAEPGFYEGRFYIDSIEQ
VKDTFISFRGWNKGIAFVNNFNIGRFWPLFGPQCTLYVPAPILRQGENVVVILELHAPNP
GLTINLVKKPDFTCGSKQYQK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgacgacgactgtggagctcctcctcctcgtcctcctcttcctccttctcacg
gctgccgcccccggcttctcctcttcccccgaactctcttcctcccctcggtccttccat
cgccgccatggctccccgttcttgggacaggcacccaatgatcggaggtttcagatttca
gatgacatgttttggaaagatgatcgccctttccgcatcatcggcggtgatgtgcactac
ttccgtgttcttccgcagtactggcgagatagactcttacgagcaaaagctcttggcctg
aatacgatccagacttatgttccttggaatttgcatgaaccagagccaaacaaatgggta
tttgagggtattgcggacattgaagcctatttaaagcttgcccaggaattaggatttctt
gttatgcttcgagctgggccatatatatgtgcagaatgggacttgggaggtttccctgcc
tggttacttgcgatagaaccaccgcttaaactcagatcatcagacatgacatttcttcat
tatgttgaaagatggtgggccgtctttcttccaagaatagctccactattgtatcaaaat
ggaggccccatcattatggttcaggttgaaaatgagtttggatcatatggggatgacaaa
gcatatctacatcatctagttactttggctagaaagcacctcgggcatgacattattctg
tatactacagatggaggttctagagaaactctggacaagggaacaattcctggagagggt
gttttctcagctgttgatttttcaactggtgaggatccatggcctatatttgagttgcag
aagaagtataatgccccaggacaatcaccacctctctcagcagaattctatacaggttgg
cttacacattggggtgagcagaatacagaaactgatgccaatcgcacagctgcagctcta
gaaaatattttatctcgaaatggctctgccgtgctctatatggctcatggtggaaccaat
tttggattttacagtggtgcaaacaccgggcaaaatgaatctgattacaaggctgacctt
acatcttatgattatgatgctccaatcaaggagtctggtgatgtggataatctgaaatat
aaagcattaagaagagttattcaagaatatagtggagtagttctttctctacctcctcct
gataatggaaaaaagggatatggcttggttactgtccgtaagattgcatccttttttgag
gtccttgatggcatgattaacccaaggactgctgttgaaagtgaacaacctatggcaatg
gaatcagttggccagatgtttgggtttctgctgtatgtttctgaattacctataatggga
acgagtagcattttaaagattcagaaggtgcatgatagagcccaagtttttgtttcatgc
acaatggataagaatggaggtagtcctagacatgttggtgtgattgaaagatggtcaaat
agggaacttgtgattcccaaagtttcttgttcttctaatatcagcttatttattctggtg
gaaaatttgggccgtgttaattatggaaagtacatctttgatagaaagggaatactctct
aatgttaccgttgatggagccgtcattcttgggtggaagatgtatccaatttcactggac
atatgtagcaaacttttcaatgtcaacccaatcaagcaagtttctatttctaggacagag
aagatttcagcagaaccaggattttacgagggccgtttctacattgattcgattgaacaa
gttaaagatacatttatatcttttcgtggttggaacaaagggattgcttttgtaaacaat
tttaatattggaagattctggccgttgtttggaccccaatgcacgctttatgtgcctgca
cctatacttcggcaaggagaaaatgttgtggtcattttagagttacatgcgccaaatcct
ggtctcacaatcaacttggtgaagaagccagatttcacttgcggatcaaagcaataccag
aagtga

DBGET integrated database retrieval system