KEGG   Mycolicibacterium vanbaalenii: Mvan_2581Help
Entry
Mvan_2581         CDS       T00449                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00250  Alanine, aspartate and glutamate metabolism
mva00280  Valine, leucine and isoleucine degradation
mva00410  beta-Alanine metabolism
mva00640  Propanoate metabolism
mva00650  Butanoate metabolism
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
Module
mva_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mvan_2581
   00650 Butanoate metabolism
    Mvan_2581
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mvan_2581
   00280 Valine, leucine and isoleucine degradation
    Mvan_2581
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mvan_2581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mva01007]
    Mvan_2581
Enzymes [BR:mva01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mvan_2581
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mvan_2581
Amino acid related enzymes [BR:mva01007]
 Aminotransferase (transaminase)
  Class III
   Mvan_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABM13389
UniProt: A1T889
LinkDB All DBs
Position
complement(2722139..2723479)
Genome map
AA seq 446 aa AA seqDB search
MSALEQSRHLATAIPGPRSCELIARKSAAVARGVGTTMPVYAARAFGGIVEDVDGNRLID
LGSGIAVTTIGNASPKVVERAAEQLHKFTHTCFMVTPYEGYVAVAEALNRLTPGDGDKRT
ALFNSGSEAVENAVKIARSYTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKHGFGPFAPE
IYRAPLSYPFRDAEFGKELATDGELAARRAITVIDKQVGADNLAAVIIEPIQGEGGFIVP
AEGFLPTLLEWCHANGVVFIADEVQTGFARTGAMFACEHEGIVPDLIVTAKGIADGMPLS
AVTGRAEIMDAPHVSGLGGTYGGNPVACAAALATIETIESDGLVARAAQIETLMKDKLGR
LQAEDDRIGDVRGRGAMIAVELVKPGTLEPDPELTKNLLAAAHRAGVIVLSCGTFGNVLR
FLPPLAISDELLLEGLDVLELILRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctctcgaacagagccgccacctcgccacggccatccccggtccccggtcctgc
gagctgatcgcgcgcaagagcgccgcggtggcccgcggggtgggcaccaccatgcccgtc
tacgcggcgcgggccttcggcggcatcgtcgaagacgtcgacggcaaccggctgatcgat
ctcggctcgggtatcgcggtcaccacgatcggcaacgcctcccccaaggtcgtcgaacgg
gccgcagagcaacttcacaagttcacccacacctgcttcatggtgaccccctacgagggt
tacgtggccgtcgccgaggcgctcaaccgactcacccccggtgacggcgacaaacggacg
gcgctgttcaactcggggtcggaggccgtcgagaacgcggtcaagatcgccaggtcctac
acacgcaaacaggcggtggtgtcgttcgaccacgcctaccacggccgcaccaacctgacg
atggcgctgacggcgaagtcgatgccctacaagcacggcttcggtccgttcgccccggag
atctaccgcgcaccgctgtcgtatccgttccgcgacgcggagttcggcaaggaactggcc
accgacggcgagctggcggccagacgggcgatcacggtgatcgacaagcaggtcggcgca
gacaacctggccgcggtgatcatcgaacccatccagggcgagggcgggttcatcgtgccc
gccgagggcttcctgcccacgctgctggagtggtgccacgccaacggggtggtcttcatc
gccgacgaggtgcagaccggcttcgcccgcaccggcgcgatgttcgcctgcgaacacgaa
gggatcgttccggacctcatcgtcaccgccaagggcatcgccgacggtatgccgctgtcg
gcggtcaccggccgagccgagatcatggacgccccgcacgtcagcgggttgggcggcact
tacggcggcaacccggtggcgtgcgcggccgcactggccaccatcgagaccatcgagtcc
gacgggctggtcgcgcgggccgcgcagatcgagaccctgatgaaggacaagctgggccgg
ttgcaggccgaggacgaccgcatcggcgacgtccgcgggcgcggggcgatgatcgccgtc
gaactggtcaagcccgggacactggagccggacccggaactgaccaagaatctgctcgcc
gccgcgcaccgggccggcgtgatcgtgttgtcctgcggcacgttcggcaacgtgctgcga
ttcctgcccccgctggccatcagcgacgagctgctgctcgaaggcctcgacgtcctcgaa
ctcatcctgcgcgacctctga

DBGET integrated database retrieval system