KEGG   Methanosarcina vacuolata: MSVAZ_3358
Entry
MSVAZ_3358        CDS       T03815                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mvc  Methanosarcina vacuolata
Pathway
mvc00300  Lysine biosynthesis
mvc01100  Metabolic pathways
mvc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mvc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSVAZ_3358
Enzymes [BR:mvc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSVAZ_3358
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_7 2-Hacid_dh_C UDPG_MGDP_dh_N 3HCDH_N
Other DBs
NCBI-ProteinID: AKB45627
UniProt: A0A0E3Q7J1
LinkDB
Position
complement(4302988..4303767)
AA seq 259 aa
MALLTPNDLININRQLQEADSVVQKVTGLDIKDVCQALYGTSPLSEKVGIVPVTSGNGII
GNFSASLHAITQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDHTFLAHNIKNGKMAN
NQPCTGVIYAEIASRYLKADSKDVLVMGLGKVGFPGAAQLVQKGFRVYGYDPDARLLKRA
VSDLGVIPLDPANPKKFSTIFEATPCANTIPEAVLSENCVLSTPGIPCAISEELRKKYDV
QLVAEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccaaatgatttgataaatattaatagacaacttcaggaagccgac
tctgtcgtgcaaaaagtaacagggcttgatataaaagacgtctgtcaagctctctacggt
acttccccgctctccgaaaaagtaggtatcgtgcctgtaacttcaggaaatgggataata
ggaaacttttctgcttccctgcatgcaattacgcagtatttcggatttgacagttttgtt
acggatatgccggatgttagcggctattatgaagctgtgcagaacggagccgagatcatc
cttatggcagacgaccacactttccttgcccataacatcaaaaatggaaaaatggccaat
aatcaaccctgcacaggtgtaatttatgctgagatcgcttccagatacctgaaagccgac
tcaaaggacgtacttgttatggggcttggaaaggtaggttttcccggagcagcccaactt
gtgcagaaaggcttcagggtttacgggtatgatcctgatgcaagactccttaagagagct
gtttcagacctcggggttatcccactcgatcctgcaaatccaaaaaagttttccactatt
ttcgaggcgaccccatgcgcaaacacgattcctgaggccgtactttcggagaattgcgtg
ctttcaactccaggaattccctgcgcaatttctgaagagcttcgaaagaaatacgacgtt
caacttgtagctgagccccttggaataggaacggcatcaatgctgtattctgtgctttaa

DBGET integrated database retrieval system