KEGG   Moritella viscosa: MVIS_3284Help
Entry
MVIS_3284         CDS       T03770                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mvs  Moritella viscosa
Brite
KEGG Orthology (KO) [BR:mvs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MVIS_3284 (ahpF)
Enzymes [BR:mvs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MVIS_3284 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Thioredoxin_3 Pyr_redox FAD_binding_2 GIDA DAO HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin NAD_binding_7 Thioredoxin_9 NAD_binding_8 Thi4 K_oxygenase Thioredoxin_4 DUF4404
Motif
Other DBs
NCBI-ProteinID: CED61192
UniProt: A0A090IJ24
LinkDB All DBs
Position
1:3736930..3738525
Genome map
AA seq 531 aa AA seqDB search
MLDQNMKTQLKAYLENLKTEVQLVLTLDDSDTAQKLHTLANDIASLSEKVIVIEDQSAST
RKPIMQVINPIKQTAIGFAGLPMGHEFTSLILALLHSGGHPMKLDAELIKQIANLEGEMN
FEIFISLSCQNCPDVVQALNMMAATNPNIKTTMIDGAAFQDEVAERNIMAVPSVYLNGKV
FTQGRISLTEILSKVDTGAAKKQAIALNEKEPYEVLVVGGGPAGASAAIYAARKGIRTGV
VAERFGGQVMDTMAIENFISVKETQGPKLAAALEEHVKEYDVDIMNEQRASGLVSAEKTA
DGYIHVELDSGAILKSRSVILSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKVA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLVNKANSMANIEIIKQAQTTEVIG
DGTRVTALNYVDRATGDAKQIELAGIFVQIGLMPNSDFLKGSGVALSPRGEIEVNAKGET
SVAGVFAAGDVTTVPYKQIIIAMGEGSKASLSAFDHLIRTPAPTAADNTQI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaaaatatgaaaacccagttaaaggcgtatttagaaaacttaaagacagaa
gtacaacttgtgctgactcttgatgacagtgataccgcgcaaaaattgcatacgttagca
aatgacattgcttcattgagcgaaaaagttatcgtgattgaagatcaaagtgcgagcacg
cgtaagccgattatgcaggtaatcaatcctatcaaacaaaccgcgattggttttgctggt
ttaccgatggggcacgaatttacttcactgatattggcactactgcacagtggtggccac
cctatgaagctagatgctgagttgattaaacaaattgccaaccttgaaggtgagatgaac
tttgaaatattcatttcattaagctgtcagaattgcccagacgttgtgcaagcattaaat
atgatggcggcaactaacccaaatatcaaaacaaccatgattgacggtgcagcgttccaa
gatgaagtagctgaacgtaatatcatggcagtgccaagtgtttacttaaacggaaaagtc
ttcacccaaggtcgtatttcattaacggaaatattatcaaaagtagatactggcgcagca
aaaaaacaagctatcgcattaaatgaaaaagaaccgtacgaagtccttgtcgttggcggt
ggtccagcgggtgcatcagctgcaatttatgcagcacggaaaggtatccgcactggcgtc
gtggcagagcgttttggtggccaagttatggatacaatggctatcgagaactttatttcg
gtaaaagaaacccaagggcctaaactcgctgcagcacttgaagaacacgtaaaagaatat
gacgtggatatcatgaacgaacaaagagcgagtggtttagtcagtgcagaaaaaacagcc
gatggctatattcatgttgaactcgatagtggcgcgatattaaaaagccgcagtgtgatc
ttatcaacaggcgcacgttggagagaaatgaacgtacccggcgaacaagaataccgtaac
aaaggtgttgcttactgcccacactgtgatggtccgttattcaaaggtaagaaagtagcc
gtgataggtggcggtaactctggtatcgaagccgcaatcgacttagcaggtattgttgaa
catgtgactgtacttgagtttgcagataccttacgtgccgatcaagtactcgtcaacaaa
gctaacagcatggctaatattgagataattaaacaagcacaaaccacagaagttatcggt
gacggtacgcgagtgactgcacttaattatgtagaccgtgcgactggtgatgcaaaacag
atcgaacttgctggtatctttgtacaaattggtttgatgccaaacagtgacttcttaaaa
ggcagtggtgttgctttatcacctcgtggtgaaattgaagtgaatgccaaaggtgaaacc
tctgttgcaggtgtatttgcagccggtgacgtaaccacagtgccttataagcaaattatt
attgcgatgggtgaaggttcaaaagccagtttaagtgcatttgaccatttaattcgtact
ccagcgccaactgcagcagacaacacgcaaatataa

DBGET integrated database retrieval system