Myotis davidii (David's myotis): 102763160 Help Entry 102763160         CDS       T02992                                  Name (RefSeq) tubulin alpha-1C chain   KO K07374   tubulin alpha Organism myd  Myotis davidii (David's myotis) Pathway myd04145   Phagosome myd04210   Apoptosis myd04530   Tight junction myd04540   Gap junction myd04814   Motor proteins myd05010   Alzheimer disease myd05012   Parkinson disease myd05014   Amyotrophic lateral sclerosis myd05016   Huntington disease myd05020   Prion disease myd05022   Pathways of neurodegeneration - multiple diseases myd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myd00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102763160   09143 Cell growth and death    04210 Apoptosis     102763160   09144 Cellular community - eukaryotes    04530 Tight junction     102763160    04540 Gap junction     102763160   09142 Cell motility    04814 Motor proteins     102763160  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102763160   09164 Neurodegenerative disease    05010 Alzheimer disease     102763160    05012 Parkinson disease     102763160    05014 Amyotrophic lateral sclerosis     102763160    05016 Huntington disease     102763160    05020 Prion disease     102763160    05022 Pathways of neurodegeneration - multiple diseases     102763160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:myd03019]     102763160    03036 Chromosome and associated proteins [BR:myd03036]     102763160   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myd04812]     102763160    04147 Exosome [BR:myd04147]     102763160 Messenger RNA biogenesis [BR:myd03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      102763160 Chromosome and associated proteins [BR:myd03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      102763160 Cytoskeleton proteins [BR:myd04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     102763160 Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102763160   Exosomal proteins of other body fluids (saliva and urine)    102763160   Exosomal proteins of colorectal cancer cells    102763160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin Tubulin_3 Tubulin_C Motif Other DBs NCBI-GeneID:  102763160 NCBI-ProteinID:  XP_006755623 LinkDB All DBs Position Un AA seq 247 aa AA seqDB search MPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITG KEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLME RLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEVIYDICRR NLDIECPTYTNLNCLISQIMSSITASLRFDGALNVDLTEFQTNLVPYPHIHFPLATYAPV ITAEKAY NT seq 741 nt NT seq  +upstreamnt  +downstreamnt atgccaagtgacaagaccattggcgggggagatgactccttcaacaccttcttcagtgag acgggcgctggcaagcatgtgcccagggcagtgtttgtagacctggaacccacagtcatt gatgaagttcgcactggtacctaccgtcagctcttccaccctgagcagctgatcacaggc aaggaagatgctgccaataactatgcccgtggacactataccattggcaaggagatcatt gacctggtcctggaccgaattcggaagctggctgaccagtgcacaggccttcagggcttc ttggttttccacagctttggtgggggaactggttctgggttcacctccctgctgatggaa cgtctctccgtcgattatggcaagaagtccaagctggagttctccatttacccggccccc caggtctccacagctgtagttgagccctacaactccatcctcaccacccacaccaccctg gagcactctgattgtgccttcatggttgacaatgaggttatctatgacatctgtcgtaga aacctagatattgagtgcccaacctacactaatcttaattgccttattagccagatcatg tcctccatcactgcatccctcaggtttgatggagccctgaatgttgatctgactgaattc cagaccaacctggtgccctatccccacatccacttccctctggccacatatgcccctgtc atcactgctgagaaagcctac

DBGET integrated database retrieval system