KEGG   Mizuhopecten yessoensis (Yesso scallop): 110443185Help
Entry
110443185         CDS       T05079                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi03030  DNA replication
myi03410  Base excision repair
myi03420  Nucleotide excision repair
myi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:myi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110443185
   03410 Base excision repair
    110443185
   03420 Nucleotide excision repair
    110443185
   03430 Mismatch repair
    110443185
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:myi03032]
    110443185
   03400 DNA repair and recombination proteins [BR:myi03400]
    110443185
Enzymes [BR:myi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110443185
    6.5.1.6  DNA ligase (ATP or NAD+)
     110443185
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110443185
DNA replication proteins [BR:myi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110443185
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110443185
DNA repair and recombination proteins [BR:myi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110443185
   NER (nucleotide excision repair)
    Other NER factors
     110443185
   MMR (mismatch excision repair)
    Other MMR factors
     110443185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 110443185
NCBI-ProteinID: XP_021342907
LinkDB All DBs
Position
Unknown
AA seq 1082 aa AA seqDB search
MQRSITAFFASPRVKNKEEEKTIEKKDDSKKKVPKKSPLKPKNSSPPKKDLDSPVKAPSK
KKSRARIIESDDEYEEENNKESVAMETEEADQTKDVEKEEKTDKNDEKGEDEKEEDSGVS
SQSSTEVTATSPAAKSPFGIPVRKTARKSMGSKRKTLNYSDEDKTPSKKSKMGSKTEEEG
AETTDKSPEKSTKGKEKSTGSKKNNKSKKEKPEEKTDCENVEMEDEDKGSKGDKKEETNS
KKTDSDDVEMKSDEEPSEEESNKTRKGSAKASPKTRKDSTKSNKKSPKEKKEKTPKVKKE
SKKKSPKSKKESKKEPAEESKSASDTEIDKREEEEESKEEKKVSIKAEPKTPVHSFFAPK
KTTVKTEDNKEEIKTEQKKDKSKEEGTQKEENSKKKENKEEEKAVKKETATKINPFGSKK
EETSTYHPSKSRYHPIDDACWKPKEKVPYLALAKTFEAIEEISARLKIVDILCNFFRSVI
ALSPDDLLFCVYLCLNKLAPAYEGVELGIGETVLMKAIAQSTGRSMDKIKLDAQEKGDLG
IVAESSRSNQRTMFAPPKLTIRAVFTKLKEIALMSGNNVMSKKIDIIKGLFVACRQSEAR
YLIRSLGGKLRIGLAEQSVLTALGNAVFLTPPGQDFPPEILDAGKGLSAENLKKKMEESA
LTIKSVYCECPNYGSIISTLMKKGIEDLPKHCKLTPGIPLKPMLAHPTKGVGEVLKRFEN
AEFTCEYKYDGERAQIHILENGTVNIYSRNSENNTTKYPDIIARVPKVMKDSVKSCVIDS
EAVAWDAEKKQIQPFQVLSHRKRKDADASEIKIQVCVYAFDLLYLNGESLVKEPFKRRRE
LLHESFEEVEGEFVFAKSMISSDTEEIAVFLDESVKGNCEGLMVKTLDVDATYEIAKRSH
NWLKLKKDYLEGVGDTLDLVVIGGYLGSGKRTGKYGGFLLACYEPESEEFQSICKIGTGF
KDDDLEQHATFFKEQLIDKPKQYYCWDSSHEPDHWFEPVQVWEVKCADLSISPTHRAASG
IVDPEKGISLRFPRFLRIRDDKKPEDATSASQVADMYKNQDQIQNQQSTSGPSKEGDEEE
FY
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgatcgataacagcattctttgcttccccaagggtgaaaaacaaggaagaagaa
aagaccatagaaaagaaagatgattctaaaaaaaaggttccaaagaaatctcccctgaaa
cctaagaattcatctccaccgaaaaaagacttggattctccagtcaaagctcctagcaaa
aagaaaagtcgagctcgaattatagaaagtgatgatgagtatgaggaagaaaataacaag
gagtctgttgccatggaaacagaagaagcagatcaaacaaaagatgtagagaaagaagaa
aagaccgataagaatgacgaaaagggagaagatgaaaaagaagaagactctggtgtatct
tctcagtcttccacagaagtaacagctacctctccagcggctaaatcaccatttggaatc
cctgtcaggaaaactgctcgtaaatcaatgggtagcaagagaaaaacattgaactacagt
gatgaggataaaacaccatccaagaaaagtaagatggggtctaagacagaggaagaaggg
gctgaaacaactgacaaatcaccagaaaaatcaacaaaaggaaaggaaaagtcgacaggc
tctaaaaaaaataataaatcaaagaaagaaaaacctgaggaaaagacggattgtgaaaat
gttgaaatggaagacgaggacaagggatcaaaaggagataaaaaggaagaaacaaattcg
aaaaagaccgattcagatgatgttgagatgaagtctgatgaagaaccaagtgaagaggag
tcgaacaaaaccagaaaaggcagtgctaaagcttcaccgaaaaccagaaaggattctaca
aaaagtaataaaaagtcacccaaggagaaaaaagagaaaacacctaaagttaaaaaagaa
agtaagaaaaaaagtccaaaatctaaaaaagaatctaaaaaagaaccagcggaggaaagt
aaatctgcatcagacacagaaattgacaaaagagaggaagaagaagaatcaaaagaagag
aagaaagtttctataaaggctgaacccaaaactcctgtccacagcttctttgccccaaag
aaaaccacagtaaagacagaagataataaagaggagattaagacagaacagaaaaaggac
aaatcaaaggaagaaggaacacagaaggaagagaatagtaagaagaaagaaaataaggaa
gaagaaaaagcagttaagaaagaaacagcaactaaaataaacccgtttggtagtaagaag
gaagagacttccacctaccacccaagtaaatcacgctaccacccgattgatgatgcttgt
tggaaacctaaagaaaaagtaccatatcttgcactggccaagacatttgaagctattgaa
gagatatctgcaaggttgaagatcgttgatatcctgtgtaattttttccgttctgtgatt
gccctgagccccgatgatcttctgttctgtgtgtatctgtgcctcaacaagctggcccca
gcctacgagggcgtggagctggggatcggggaaaccgtcctcatgaaggccatcgctcag
tccacaggaagaagtatggacaagataaagttggatgcccaggagaagggtgaccttgga
atagttgcagaatctagtcggagtaaccagcggacaatgtttgcccctcccaagctgacc
attagagctgtgtttaccaagctgaaggaaatagcgctcatgtctggcaataatgtgatg
tctaagaagattgacatcatcaaaggtctgtttgtagcatgtcgacagtcagaggcacgc
tacctcatccgatcactaggaggcaagctcaggatcggtctggctgaacagagtgtcctc
acagctctcggcaatgctgtgttccttacacctcctggtcaagatttccctccagagata
cttgatgctggaaaaggcctgtcagctgagaatttaaaaaagaagatggaagaatcagct
cttactataaaatctgtatattgtgaatgtccaaattatggctccatcatatcaactttg
atgaagaaaggtatagaagatctacctaaacactgcaaactgaccccaggtattcctcta
aaaccaatgttggcccatccaaccaaaggtgtcggtgaggtgctaaagagatttgagaat
gcagaatttacctgtgaatacaaatatgatggagaacgtgcacagatacatatattagaa
aatggtactgtcaatatatacagtagaaattctgagaataacacaaccaagtacccagac
atcatagccagggtccctaaggtgatgaaggactctgtaaagtcctgtgtgatagactcg
gaggcagtggcctgggacgcggagaagaaacagatacagcctttccaggttcttagtcac
aggaaacgaaaggatgcagatgcatcagaaataaagatccaagtgtgtgtgtatgcattt
gacctgctctacctcaatggtgaatcacttgtgaaggagcccttcaagcgccggcgggaa
ctgctgcacgagtcgtttgaggaagtggagggagagttcgtgttcgctaagtctatgatc
tcctcagatactgaggaaatagccgtcttcctggacgaatctgtcaaaggaaactgtgaa
ggactcatggtgaaaactttagatgtagatgccacatatgaaattgcaaagaggtctcac
aattggctgaagcttaagaaagactacctggaaggtgtaggggacactctagacctggtg
gtcattggaggctatctgggatctggcaagaggacgggaaaatatggagggttcttgttg
gcatgttacgaaccagagagtgaagagttccagtccatatgtaagattggtacagggttc
aaggatgatgatctggagcagcatgctacattcttcaaggagcagctgattgacaagcca
aaacagtactactgttgggacagttcccacgagcctgaccactggtttgagcccgtccag
gtgtgggaggtcaagtgtgctgacctctccatatcacccactcacagggcagcgtcaggc
atcgtcgatccagagaaaggtatttctctacggtttccacggttcctgagaatccgagac
gataagaaaccagaagatgccacctcagcctcacaggtggcagacatgtacaaaaaccag
gaccagattcagaaccaacagtcaacctcagggccaagcaaggagggagacgaggaagag
ttctattga

DBGET integrated database retrieval system