Myxococcus hansupus: A176_000517 Help Entry A176_000517       CDS       T04077                                  Name (GenBank) hypothetical protein   KO K16937   thiosulfate dehydrogenase (quinone) large subunit [EC:1.8.5.2] Organism mym  Myxococcus hansupus Pathway mym00920   Sulfur metabolism mym01100   Metabolic pathways mym01120   Microbial metabolism in diverse environments Brite KEGG Orthology (KO) [BR:mym00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     A176_000517 Enzymes [BR:mym01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.5  With a quinone or similar compound as acceptor     1.8.5.2  thiosulfate dehydrogenase (quinone)      A176_000517 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AKQ63605 UniProt:  A0A0H4WQK6 LinkDB All DBs Position 609404..609661 Genome browser AA seq 85 aa AA seqDB search MLLVGIQVRSVLVSGALLMLVLIGGACSAQNWSAASIQMIYLGFCVVLLATVHLDHLSVD AWMRGSGPLRGIPPWGRITGCWRAR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ttgctgctggtgggcatccaggtccggagcgtgctcgtatcgggcgcgctgctgatgctg gtgctgattggcggcgcctgctccgcgcagaactggagcgccgcgagcatccagatgatc tacctcgggttctgcgtcgtcctcctcgccacggtgcatctcgaccatctctcggtcgat gcgtggatgcgtggcagcggcccgttgcgaggcatccctccgtgggggcgcatcaccggt tgttggcgggctcggtga

DBGET integrated database retrieval system