KEGG   Mycobacterium sp. NRRL B-3805: MyAD_12305Help
Entry
MyAD_12305        CDS       T05013                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00250  Alanine, aspartate and glutamate metabolism
myn00280  Valine, leucine and isoleucine degradation
myn00410  beta-Alanine metabolism
myn00640  Propanoate metabolism
myn00650  Butanoate metabolism
myn01100  Metabolic pathways
myn01120  Microbial metabolism in diverse environments
Module
myn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:myn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MyAD_12305
   00650 Butanoate metabolism
    MyAD_12305
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MyAD_12305
   00280 Valine, leucine and isoleucine degradation
    MyAD_12305
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MyAD_12305
Enzymes [BR:myn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MyAD_12305
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MyAD_12305
Amino acid related enzymes [BR:myn01007]
 Aminotransferase (transaminase)
  Class III
   MyAD_12305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMO05835
LinkDB All DBs
Position
complement(2611015..2612358)
Genome map
AA seq 447 aa AA seqDB search
MPAVEQSRHLATAIPGPKSSALIERKNSAVARGVGTTMPVYAARAAGGILEDIDGNRLID
LGSGIAVTTIGNAAPRVVDAVTAQVDLFTHTCFMVTPYEGYVAVAEHLNRLTPGSGDKRS
ALFNTGSEAVENAIKIARSYTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPFRDAEFGKELAEDGELAAKRAITVIDKQIGADNLAAVIIEPIQGEGGFIVP
APGFLPALLAWCRDNNVVFIADEVQTGFARTGAMFACEHEGIEPDLIVTAKGIADGLPLS
AVTGRAEIMDAPHVSGLGGTYGGNPIACAAALATIETIETDGLVARAGAIERLMKDRLHR
MQADDDRIGDVRGRGAMIAVELVKSGGTEPDADLTKALCAAAHAKGVIVLSCGTYGNVLR
FLPPLAISDDLLNEALEILAEALAALR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccgtcgaacagagccgccatctcgccaccgccatccccggcccgaagtcctcg
gcgctgatcgagcgcaagaattccgcggtcgcccgcggtgtcggcacgacgatgcccgtc
tacgccgcacgtgccgccggcggcatcctggaggacatcgacggcaaccggctgatcgac
ctcggttcgggcattgccgtcaccaccatcggcaacgccgcgccgcgggtggtcgacgcg
gtgaccgcgcaggtcgatctgttcacccacacctgcttcatggtgacgccctacgagggt
tacgtcgccgtggccgaacacctcaaccggctcacccccggcagcggggacaagcgttcg
gcgctgttcaacaccggatccgaggcggtcgagaacgcgatcaagatcgcccgctcctac
acccgcaagcaggccgtggtgtccttcgaccacgcctatcacggccgcaccaacctcacg
atggcgctgaccgccaaatcgatgccctacaagagtggtttcggcccgttcgccccggag
atctaccgggctccgctgtcgtatcccttccgcgacgcggagttcggcaaggagttggca
gaggacggcgaactggcggccaagcgcgccatcaccgtcatcgacaagcagatcggcgcc
gacaacctggccgccgtcatcatcgagcccatccagggcgagggcggattcatcgtcccc
gcaccgggattcctgcccgcactgctcgcctggtgccgggacaacaatgtggtgttcatc
gccgacgaggtgcagaccgggttcgcgcggaccggggcgatgttcgcctgtgagcacgag
ggcatcgaacccgacctgatcgtcaccgcgaagggcatcgccgacgggctgcccctctcg
gcggtcaccgggcgcgccgagatcatggatgccccgcacgtgtccgggctcggcggcacc
tacggcggcaatccgatcgcctgcgccgcggcgttggcgaccatcgagaccatcgagacc
gacggcctggtggcccgcgccggtgccatcgaacggctcatgaaggaccggctgcaccgg
atgcaggccgacgacgaccggatcggcgatgtgcgtggccgcggtgcgatgatcgccgtg
gaactggtcaagtccggtggcaccgaacccgatgcagatctgaccaaggcgctgtgcgcg
gccgctcacgccaagggtgtcatcgtgttgtcctgcggtacctacggcaacgtgttgcgt
ttcctgccgccgctggcgatcagcgacgacctgctgaacgaggccctcgagatcctggcc
gaggcgctggccgcacttcgctga

DBGET integrated database retrieval system