KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_33190Help
Entry
OEM_33190         CDS       T02732                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo00250  Alanine, aspartate and glutamate metabolism
myo00280  Valine, leucine and isoleucine degradation
myo00410  beta-Alanine metabolism
myo00640  Propanoate metabolism
myo00650  Butanoate metabolism
myo01100  Metabolic pathways
myo01120  Microbial metabolism in diverse environments
Module
myo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:myo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OEM_33190
   00650 Butanoate metabolism
    OEM_33190
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OEM_33190
   00280 Valine, leucine and isoleucine degradation
    OEM_33190
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OEM_33190
Enzymes [BR:myo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     OEM_33190
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     OEM_33190
Amino acid related enzymes [BR:myo01007]
 Aminotransferase (transaminase)
  Class III
   OEM_33190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGP64854
UniProt: S4ZCY6
LinkDB All DBs
Position
3589701..3591044
Genome map
AA seq 447 aa AA seqDB search
MVAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGIIEDVDGNRLI
DLGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGSGEKR
SVLFNSGAEAVENAVKVARAYTRKSAVVAFNHAYHGRTNLTMALTAKSMPYKAGFGPFAP
EVYRAPLSYPYRDGLIDKELATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIV
PAEGFLPTLLEWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPL
SAVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQLERLITEPLL
RLQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQKLTVAAQAAGVIVLTCGMFGNII
RLLPPLTIGDELLAEGIDILSGLLRDL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggtggccggcctcgagcagactcgccaactggtcaccgagatccccggcccgctctcg
ctggaactgagcaagcgccgggcggcggcggtgtcgcacgcggtcaacgtctccgtcccg
gtcttcgtggcgcgcgccggcggcggcatcatcgaggacgtcgacggcaacaggctcatc
gacctcggctccggcatcgcggtgacgaccatcggcaactcggcgccccgggtggtcgac
gccgtgcgcgcgcaggtcgccgagttcacccacacctgcttcatggtgacgccgtacgag
tcgtacgtcgctgtcgccgagacgctcaaccggatcaccccgggctccggcgagaagcgc
tcggtgctgttcaattccggcgccgaggccgtcgagaacgccgtcaaggtcgcgcgcgcc
tacacgcgcaagtccgcggtggtggcgttcaaccacgcctaccacggccggaccaacctg
acgatggcgctgaccgcgaagtccatgccctacaaggccggcttcggcccgttcgcgccg
gaggtctaccgggcgccgctgtcctacccctatcgggacggcctgatcgacaaggagctg
gccaccgacggggagaaggccgccgcgcgggccatccgggtcatcgacagccagatcggc
gccgacaacctggccgccctcctgatcgagccgatccagggcgaaggcgggttcatcgtg
ccggccgagggattcctgcccaccctgctggagtggtgccgcaggaacgacgtggtgttc
atcgccgacgaggtgcagaccggtttcgcgcgctcgggcgccatgttcgcctgcgaacac
gagggcatcgagcccgacctgatctgcaccgccaaggcgatcgccgacgggcttcccctg
tcggcggtcaccggccgggccaacatcatggacgcgccgcacgtcggcggcctcgggggc
accttcggaggcaaccccctggcctgcgcggcggccttggccacgatcgagacgatcgag
agcgacgggctggtcgagcgggcccagcagctggagcggctgatcaccgaaccgctgctg
cggctgcaggccggcgacgaccggatcggcgacgtccgcggccgcggcgcgatgatcgcg
atcgagttggtgaagtcggggaccgccgagcccgacaaggagctgacccagaagctgacc
gtcgccgcccaggcggccggcgtcatcgtcctgacctgcggcatgttcggcaacatcatc
cggctgctgccgccgctgaccatcggcgacgagctgctggccgagggaatcgacatcttg
agcgggttgttgcgcgacctgtaa

DBGET integrated database retrieval system