KEGG   Maylandia zebra (zebra mbuna): 101468640
Entry
101468640         CDS       T02814                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00230  Purine metabolism
mze01100  Metabolic pathways
mze04020  Calcium signaling pathway
mze04114  Oocyte meiosis
mze04261  Adrenergic signaling in cardiomyocytes
mze04270  Vascular smooth muscle contraction
mze04371  Apelin signaling pathway
mze04540  Gap junction
mze04912  GnRH signaling pathway
mze04914  Progesterone-mediated oocyte maturation
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101468640
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101468640
   04020 Calcium signaling pathway
    101468640
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101468640
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101468640
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101468640
   04914 Progesterone-mediated oocyte maturation
    101468640
   04916 Melanogenesis
    101468640
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101468640
   04270 Vascular smooth muscle contraction
    101468640
Enzymes [BR:mze01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101468640
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053 OPA3
Other DBs
NCBI-GeneID: 101468640
NCBI-ProteinID: XP_004569165
UniProt: A0A3P9DHP8
LinkDB
Position
LG11
AA seq 1121 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRTSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIILMCAVVYTADKLASVLVASVGLAADII
LYLLCRFGLLPDRISRRVLPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSVF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQDDIHGAALGRQLLANLVIYVCAITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKGPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYRDDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIDTYLVVVPKAPVGKNGINSVKLSVTSSNGNSPLLINTTDCNGSVHTACTTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNKLSLRFVDPELETRFSVEKEKQSGAAFCCSCVVLLFTAVMEALIDPWLIANYITFAVG
EVLLLILTICSLAAIFPRVFAKKLVSFSTWIDHTRWARNTWAMTAIFILTMADIMDMLSC
LPQVPDSDTTTVAPSSSLSTVSSLEGCLNNPKYYSYVAVLALMATTMLVQVSHMVKLTLM
LLITVATGVVNIYSWKDIFDRYDMARFHDYRSYLVPSKFAMTVMIFIMMVSFYYFSRHVE
KLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDE
IGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTY
MAASGVTPDVSNGYNSIKKEELSDTERWQHLADLADFALAMKVTLMNINYQSFNNFMLRI
GLNKGGVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFVR
RGPIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgcctcggaaccgagccttttctgagcccgagtattctgctgagtattcagcagactgc
tctgtgacgttgccctctgaccccgggcaggcagtggggcgaacacacgaggtcacggtg
cggacctcgggatgctgcctctgtctgccgcgtttcatgcgcctgacctttgcgcccgag
tccttggagaatctttaccagacctactttagacggcagagacacgaaacgctgctggtg
ctcgttgtgtttgccgcgctgttcgacagctacatcatcctcatgtgtgctgtggtctac
accgctgataagctggcttctgttttagtggcatcagtgggactggcagcagatatcatt
ctctatctgctgtgccgctttgggctgctgccagaccgcatctcccggcgggtgttgccc
tatgccctgtgggtgctcatagcggctcagatattctgctacctggggttgaattatgct
cgcttccaccaggccagcgacactgtaggctggcaggctttcttcagtttttcggttttt
ctgactctgcctttgagactgactcccattgtgctcatcaccactgtgtcctgtggggtc
cacaccctggttctgggtgtcaccattgcccagcagcagcaggatgacatacacggcgca
gcactcggcagacagcttctagccaaccttgtgatttatgtttgtgccatcactgtgggc
atcatgtcgtactacatggctgatcggaaacatcggaaggcctttctggaggcgagacag
tcgctggaggtcaaactcaacctggaggagcagagtcaacaacaggagcgtctgctcctc
tccattcttccaaagcacatagctgatgaaatgcttcaggacatgaagaaggggcctagt
cagaaagaaatgcaacagttcaacaccatgtacatgtacaggcatgaaaatgtcagtatt
ttgtttgcagacattgtgggcttcacccagctgtcgtcttcttgcagtgctcaggagctt
gtcaagctgcttaatgagctctttgcccgctttgacaaactagctgctaaataccaccag
ctaaggatcaagatcctgggagactgctactactgtatctgtgggctgccggactacagg
gacgaccacgccgcctgctctatcatgatgggcctggccatggtggaggccatttcgtat
gtccgagagaaaacccagacagatgtggacatgcgtgttggagtgcacagtggtacggtc
ctgggaggagtgctgggccagaaacgttggcagtatgatgtttggtccacagatgtcaca
gtggccaataaaatggaggctggagggatcccaggccgtgtgcacatctcacaaagcacc
atggagtgtcttcatggtgagtttgatgtggagccggggaatggcggtgaccgctgtgac
tacctgagggagagaggcatagacacctacctggtggttgttccaaaagcacctgtggga
aagaatggcattaacagcgtcaaactgtccgtaacctcgtccaatggaaattcccctctg
ctgatcaacaccacagactgtaatggcagtgttcacacagcctgcaccacaccagaggaa
ccagaggagctggacacaagggtggtgaacccatcgtttcctaatccccgaaggaggctg
aggctgcgggacctggctgaacgggtgattgatgctcaggagaatgaacaggagctcaac
aaactccttaatgaagctctgctggagagagaaacggttcaagctctgaaggggaaacac
accaacaagctgtccctcaggtttgtggatccagagctggaaacacgtttctctgtggag
aaggagaaacagagcggggctgccttctgctgctcctgtgtggttctgctctttactgca
gtgatggaggcgctcatagacccctggctgattgcaaactacatcacctttgcagtgggg
gaggtcttactgctcatcctgaccatttgttctctggctgccatcttccccagagtcttt
gccaaaaagctggtgtctttctccacctggattgaccacacacgttgggctcgcaacact
tgggccatgaccgccattttcatcctaaccatggctgacataatggacatgcttagttgt
ctgcctcaggtcccagactcagacaccaccacagtggccccctcctcctcgttgtccacc
gtgtccagccttgaaggttgcctgaacaatcccaaatattacagctacgttgctgtgctg
gcactgatggccaccacaatgctggttcaggtcagtcacatggttaagcttaccctgatg
ctgctcatcacagtggccacgggcgtcgttaacatctacagctggaaggacatctttgac
cgctatgacatggcccgcttccacgactacaggtcgtacctggtcccatctaaattcgcg
atgacagttatgatcttcattatgatggttagcttctattacttctccagacatgtggag
aagcttgcccgtaccctcttcctctggaagattgaggttcatgagcaaaaggagaaggtg
tatgagatgcggcgctggaacgaagcgctggtgaccaacatgctgcctgaacatgtggct
cgacacttcctaggatccaagaaaagggacgaggagctgtacagccagtcatatgacgag
atcggagtcatgttcgcttctatccccaacttctctgacttttacacagaggagagcatc
aataatggaggcatcgaatgcttgcgctttctcaacgagatcatctcagactttgacagt
ctgctggatgagcctcagtttcgctgcattacaaaaatcaagactattggcagcacatac
atggcagcgtcaggtgtcaccccggacgtcagcaacggttacaactccatcaagaaggaa
gagctgtcggacaccgagcgctggcagcacctggcagacctcgcagactttgcgctggcc
atgaaggttacacttatgaacatcaactaccaatcattcaacaatttcatgctgcgcatc
ggtctaaataagggaggggtgctagctggagtgattggtgctcgcaaaccccactttgac
atctggggcaacactgtcaacgtggcaagccgcatggagtccacaggtgtgatgggcaac
atccaggtagtggaggactgctacaacatcctgaaggagtatggcttccgcttcgtgagg
agagggcccatctttgtgaaggggaaaggagagctgctcacttattttctgaagggaaga
gacaaacaaggctcatttatcaacggctcctctgtcactctgccacatcaggtggtggat
agttga

DBGET integrated database retrieval system