KEGG   Maylandia zebra (zebra mbuna): 101479420Help
Entry
101479420         CDS       T02814                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00590  Arachidonic acid metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101479420
Enzymes [BR:mze01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101479420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosducin An_peroxidase EGF Thioredoxin
Motif
Other DBs
NCBI-GeneID: 101479420
NCBI-ProteinID: XP_004549809
LinkDB All DBs
Position
LG7
AA seq 845 aa AA seqDB search
MRASVLGSACALLLLLREPACRGDDVTSSTVNPCCSFPCQHWGVCVRYGQDKYECDCTRT
GYYGENCTVPELWTRVRQFFRPNPGVVHYILTHFHWLWDIINHTFLRDVLMRLVLTVRSN
LIPSPPTFNSKYDYLSWESYYNLSYYTRLLPPVPKDCPTPLGVKGKAGLPDPEVLVERLL
KRRTFRPDPQRTSLMFAFFAQHFTHQFFKTFNRMGLGFTKAVGHGVDAGHIYGDSLDRQL
NLRLLKDGKLKYQLIDGEMYPPSVADASVRMSYPPGVPAEAQMAIGQEVYGLLPGLGMYA
TLWLREHNRVCDILKAEHPTWDDEQLFQTTRLIIIGETIRIVIEDYVQHLSGYLLQLKFD
PTLLFGSPFQYGNRIALEFSQLYHWHPLMPDSFLINGDELSYEQFLFNTSVLTHYGVEAL
VDSFSRQIVGQIGGGHNINAMVTKVAVETIKESRELHLQSFNQYRKRFNLTPYTSFREFT
DNEEIARDLEELYDDIDALEFYPGLLLEKTRAGAIFGESMVEMGAPFSLKGLLGNPICSP
EYWKPSTFGGKVGFEIVNSATLKKLVCQNTRTCPYVSFRVPAEEKQEHGREGDRAQTDEL
XPLQTSEGPKGVINDWRKYKQLEVEQKQEQKKEMERLIKKLSMTHSSDFVCSFLSASQMT
MQEYNMLQEEEDDEEFLQHYRMQRIEEMRRQLCRGKRFEQVYELNSGEEFLEALDKEDKS
TLVMIHIYEPDVPGCEAMSGSLMCLAQEYPLVKFCSVRSSAISTSALFRDSALPALLVYK
AGDLIGNFVRLTDQLGEDFFAVDLEALLREYGLLPEKPPVVPKMVRNGAIIQSTVSDEDS
DLDID
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctctgtcctaggatcagcctgtgcgcttttgttgctgctgcgggagcctgcg
tgtcggggtgatgacgttacctcgagcacagtcaatccatgctgttccttcccctgtcag
cactggggtgtgtgcgtccggtacggtcaggacaagtatgagtgtgactgcactcgtacc
ggctactacggagaaaactgcacagtccccgagctttggacccgagtgcgtcagtttttc
aggcccaacccaggtgtggtgcactacattctcacccacttccactggctctgggacatc
atcaaccacactttcctgcgggacgtcctcatgcggctggtgttaacagtgaggtcaaac
ttaattcccagccctccaaccttcaactccaagtatgactacctcagctgggaatcctac
tataatctgagctactacactcgacttctgcctccggtgccaaaggactgtcccacacct
ttgggggtgaaaggcaaggctgggctacctgaccctgaggtgttggttgagaggcttctg
aagagaaggacgttccgacccgatccccagcgcaccagcctcatgttcgccttcttcgcg
cagcacttcacccaccagttctttaagaccttcaatcgcatgggcctcggcttcactaag
gctgtcggccacggggtggacgcaggacacatttatggagacagcctggatcgtcagcta
aacctcaggcttctcaaagatggaaagctgaaatatcagttaattgatggagagatgtac
cctcccagtgtcgctgatgcatctgttagaatgagctaccctcccggagtccccgctgag
gctcagatggctatcggtcaggaagtctatggacttctccctggtttgggaatgtacgcc
acgctgtggctgagggagcacaaccgagtctgtgatatattgaaagcggagcatcccacc
tgggacgatgagcagcttttccagaccacacggctcattattatcggcgagaccatacga
atcgtgatagaagattacgtgcagcacctcagcggatacctgcttcaactcaagttcgat
cccaccctgctgttcggctctcccttccagtacggcaaccgtatcgctctggagttcagc
cagctctaccactggcaccctttgatgcccgacagcttcttaataaatggggacgagctg
tcatacgaacagtttctcttcaacacgtctgttctgacgcactacggtgtggaggccctc
gtggattccttctccaggcaaattgttgggcagattggcggtgggcacaacatcaatgcg
atggtcaccaaagtagccgttgagaccatcaaggagtcccgtgaacttcacctccagtct
ttcaaccagtacaggaagcgctttaacctcacgccatacacgtcattcagggaattcacc
gataatgaggagatagcacgagacctcgaagagctctacgatgacattgacgcactggaa
ttttaccccggcttgttgttggagaaaacacgagcgggggccatatttggagaaagcatg
gtggagatgggtgcccccttctcccttaaaggcctcctgggaaaccctatatgctctccg
gaatactggaagcccagcacctttggaggaaaggtgggctttgaaatagtaaactctgcc
acactcaagaagctggtgtgtcaaaacaccagaacgtgtccttacgtgtcatttagagta
ccagcagaagagaagcaagaacacgggcgagaaggtgacagagcgcagactgatgagcta
taacctttgcagacatcagaagggcccaagggtgtgatcaatgactggaggaagtacaag
cagcttgaggtggagcagaaacaagagcagaagaaggagatggaaagactgatcaagaag
ctgtcgatgacacactcgtctgattttgtgtgttcattcctgtctgcttcacagatgacc
atgcaggagtacaacatgcttcaggaagaagaggatgatgaagaattcctccagcattac
cgcatgcagcgcatcgaagagatgcggcgccagctgtgccgcggcaagcgttttgagcag
gtctacgagctaaacagtggggaggagttcttagaggctttagacaaagaggacaaaagc
accctggtcatgatccacatctacgagccggacgtcccgggctgcgaggccatgagcggc
agcctgatgtgtctagctcaggaatacccgctggtcaagttctgcagcgtgcgcagctca
gccatcagcaccagcgcactgttcagagacagcgctctgcctgctctgctcgtttacaaa
gccggggacctgatcggcaactttgtgcggctcacagatcagctcggggaagacttcttt
gccgtagacctggaggccctgctgcgggagtacggcttgctgcccgaaaagcctcccgtc
gtcccaaagatggttcgcaacggagccatcatacagagcactgtgagcgacgaggactct
gaccttgatatagactag

DBGET integrated database retrieval system