KEGG   Maylandia zebra (zebra mbuna): 101479550Help
Entry
101479550         CDS       T02814                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze03030  DNA replication
mze03410  Base excision repair
mze03420  Nucleotide excision repair
mze03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mze00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101479550 (lig1)
   03410 Base excision repair
    101479550 (lig1)
   03420 Nucleotide excision repair
    101479550 (lig1)
   03430 Mismatch repair
    101479550 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mze03032]
    101479550 (lig1)
   03400 DNA repair and recombination proteins [BR:mze03400]
    101479550 (lig1)
Enzymes [BR:mze01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101479550 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101479550 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101479550 (lig1)
DNA replication proteins [BR:mze03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101479550 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101479550 (lig1)
DNA repair and recombination proteins [BR:mze03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101479550 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     101479550 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     101479550 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 101479550
NCBI-ProteinID: XP_004555205
LinkDB All DBs
Position
LG18
AA seq 1013 aa AA seqDB search
MQRSIASFFQPKSKDIQKKAAEEPVKKPVKSPLKVQNGVQEAESPIKKVVKRCRQILDSD
DDEAPVVKEQVPSKGQGDKEAPGKTEKKDDAFKAVPTPLSPPSTPATPVTPTTPATPATS
ASPGTPSTPNSVSPTGIVKRKTARKMFPKRKLNESGSGSDSQKEEAEVKEEQGQQNKRPR
VETSASGEGNADEPMEEDTKEERGEKAATEANNPGDEEVENKSKEEETVEKEEQVEKKSP
DEKEEKAEEAEKKNEAKPKTDDDDDEKGPAVAKTEVVEKDTRGTEESPKSQTVKRQKEAK
EQKDKEPTRKAPISSFFAPRKAAVKTEKPEKNEGEKKTSPERKRSEEESKDTKGEATSGQ
TNYDPSRPNYHPVDNACWKQGQKVPYLAVARTFERIEEDSGRLRNIETLSNLFRSVLLLS
PDDLLCCVYLCLNQLGPAYLGMELGVGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVA
ESSRSNQRMMFQPASLTAGGVFRKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIV
RSLAGKLRIGLAEQSVLSALSQAVCLTPPGQGFPPTVIDAGKGMSAESRRAWIEEKSLIL
KQTYCEMPNYDVLIPVLLKEGIDQLPNHCKLTPGVPLRPMLAHPTKGVGEVMKKFDEAAF
TCEYKYDGERAQIHILEGGEVRIFSRNQEDNTSKYPDIISRIPKVKKDSVVSCVLDSEAV
AWDHEKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRALLR
ESFSEVEGEFVFARSIDSDNTDTIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWL
KLKKDYLEGVGDTVDLCVIGAYLGKGKRTGTYGGFLLACYDEENEEFQSVCKIGTGFKDE
DLEQHYKFLKEHILPKPRAYYRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGMVD
PEKGISLRFPRFLRIRDDKKPEDATAAAQIAELYKKQQQIQNQGDKADPEDYY
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcatcgcatccttctttcagcccaagagcaaggacattcagaagaaagct
gcagaggagcctgtgaaaaagcctgtcaagagtccactgaaggtgcagaacggtgttcag
gaagcagagtcgcccatcaagaaggttgtgaaacgctgccgtcaaatcctggacagcgat
gatgacgaggcgccagtcgttaaagaacaagttcccagcaagggacaaggagacaaagaa
gctcctggtaaaacagaaaagaaggatgatgcgtttaaagccgttcccacccccctgtct
ccaccatcgaccccagccacgcctgtaaccccgaccacccctgccactccagccacctct
gcttcaccggggacccccagcactcccaattccgtctcccccactgggatcgtcaaacgc
aagactgcaaggaagatgttccctaagaggaagctcaacgagagtgggagtggcagtgac
agtcagaaagaagaggcagaggtcaaggaggagcagggtcagcaaaacaaacggccacgt
gtggagaccagtgccagcggtgaaggtaacgcagatgaacccatggaggaggacacaaag
gaagaaaggggggaaaaggcagcgaccgaggctaacaacccaggggacgaggaggtggag
aacaagagcaaagaggaagaaactgtagaaaaagaggagcaggtggagaaaaagagccct
gatgagaaggaggagaaagctgaggaggcggaaaagaaaaatgaagcaaagccgaagaca
gatgatgatgatgatgagaaagggcctgccgtagccaaaacggaggtggttgaaaaggac
acgcgaggcacagaagagagcccgaaaagtcaaacggtgaaaaggcagaaagaagcaaaa
gagcagaaagataaggagccgaccaggaaagcccccatcagcagtttctttgctcccaga
aaagcagcagtgaagacggagaagccggagaagaatgagggggaaaaaaagacgagtcca
gagaggaagaggtcagaggaggagagtaaagacacgaaaggtgaggcaacctcaggacaa
acaaactatgatccatcgagaccaaactatcatcccgtggacaacgcttgttggaaacag
ggccagaaagtgccctacttggcagtggctcgcacctttgagaggattgaagaggactct
ggcaggctgagaaacatcgagacactgtcaaacctgtttcgctctgtgctgctgctctcc
ccagatgacctgctctgctgcgtgtatctgtgtctgaaccaactcggtcctgcctatcta
gggatggagcttggtgttggtgagacggtgctgatgaaagctgttgctcaagccactggg
cgacaattggacaaaatcaaagcagaggcacaggagaaaggagatttgggcctagtggcc
gagagctcccgtagcaaccagcgcatgatgtttcagccggccagtctgacagcagggggc
gtgttcaggaaattgaaggaaattgccagcatgagtgggaactcggccatgaataagaaa
atcgacatcatcaaaggcctctttgtggcatgccgcttttcagaggcccgctacatagtc
aggtctctggctggaaagctgaggattggtcttgctgagcaaagtgtgctctctgcactg
agccaagctgtctgcttgaccccacctggacaaggttttcctcccactgtgatcgacgca
gggaagggaatgagtgctgagagcaggcgggcgtggattgaagagaagagcctcattctc
aaacagacttactgcgagatgcccaattacgatgttctgatccccgttttgctaaaagag
ggcatagaccagctgcccaatcactgcaagctcactccaggtgtaccactgagacccatg
ttggctcacccaactaagggtgttggcgaagtgatgaagaagtttgacgaggcagcgttc
acctgcgagtacaaatacgacggggagcgtgcacagattcacattttggagggtggcgag
gttcgaatattcagccgcaaccaggaagacaacaccagcaaatacccagatatcatctcc
cgcattcccaaggtgaagaaggactctgttgtatcttgtgtcctggactctgaggcggtg
gcctgggatcacgagaagaaacagatccagcccttccaggtcctcaccacccgtaagaga
aaggatgtggatgcatcagagatcaaagtccaagtgtgtgtgtacgcctttgacctcctc
tacctcaatggcgagtccctggtgcgacagccattgtgtcggcgtcgggctctactgaga
gaaagcttctcagaggtggagggagagtttgtgtttgcccgatccatcgactccgacaac
accgacaccatcgccgagttcctggagcaatctgtccgagactcctgcgagggcctcatg
gtgaagactctagagaaggatgccacctatgaaattgccaagcgctctcataattggctc
aagttgaagaaggactacttggagggagttggagacacagtggacctgtgtgtgattggg
gcctatctggggaaaggaaaaaggacaggcacctatgggggcttcctgctggcttgttac
gatgaagaaaatgaagagttccagtccgtctgcaagatcgggacaggcttcaaggatgaa
gatctggagcagcattacaagttcttaaaggagcacatcctgcccaagccccgtgcttac
taccgcgttgaccaatcagccgagcccgacgtgtggctggatgctgtgcaggtttgggag
gtgaagtgcgctgacctctcactgtctccggtctacaaagctgcaatgggaatggtggat
ccagagaagggcatttctctgaggttccctcgcttccttaggattagagacgacaagaag
cccgaggacgccacggccgcagctcagatcgccgagttgtacaagaagcagcagcagatt
cagaatcagggggataaagctgacccagaggactactactga

DBGET integrated database retrieval system