Maylandia zebra (zebra mbuna): 101486296 Help Entry 101486296         CDS       T02814                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism mze  Maylandia zebra (zebra mbuna) Pathway mze04137   Mitophagy - animal mze04140   Autophagy - animal mze04144   Endocytosis mze04145   Phagosome mze04148   Efferocytosis mze05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mze00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101486296    04145 Phagosome     101486296    04140 Autophagy - animal     101486296    04137 Mitophagy - animal     101486296    04148 Efferocytosis     101486296  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101486296  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mze04131]     101486296   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mze04147]     101486296    04031 GTP-binding proteins [BR:mze04031]     101486296 Membrane trafficking [BR:mze04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     101486296 Exosome [BR:mze04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101486296   Exosomal proteins of other body fluids (saliva and urine)    101486296   Exosomal proteins of colorectal cancer cells    101486296   Exosomal proteins of bladder cancer cells    101486296 GTP-binding proteins [BR:mze04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     101486296 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU cobW AAA_22 Septin AAA_5 AAA_16 AIG1 PduV-EutP AAA_7 FeoB_N AAA_24 AAA_29 Motif Other DBs NCBI-GeneID:  101486296 NCBI-ProteinID:  XP_004571969 LinkDB All DBs Position LG5:8147553..8151954 Genome browser AA seq 206 aa AA seqDB search MDMSDKKGPITLKIILIGNSGVGKSSVMNRYVNHRFTNMYRATVGTDFLSKTISIDGDTV TLQIWDTAGTERFQSLGTPLYRGAHCCMLVFDVTSKASFSALDGWRKEFLIQGEPKDPSD FPFIVLGNKTDLSDREVSGKLSRQWCEEIRAEYFEGSAKEDLDVEKPFLRAAQRGLQQYK KHTLENTGHFQITCKQPRETRNTCEC NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggatatgagtgacaaaaagggtcctattacactgaaaataatcctcataggaaactct ggggtgggaaaatcctccgtcatgaacagatacgtgaatcaccgcttcaccaacatgtac cgggccactgtggggaccgacttcctctctaaaacaatcagcatagatggggacacagtc acgctgcagatctgggacacagcaggcacagagaggttccagtctctgggtacacctctg tacaggggagctcactgctgcatgctggtgtttgatgtcacatccaaggccagcttctct gctctggatgggtggaggaaggagtttttgatccaaggggaacccaaggatccttctgat ttcccttttattgtactgggcaacaaaacggatctgagcgaccgagaggtgtctggcaag ctgtcccggcagtggtgcgaggaaattagagctgaatactttgaaggaagtgccaaagaa gatctggatgtagagaagccgtttttgagagcggctcagcgtggcttacagcagtacaaa aaacacacattggaaaatacaggacatttccagataacctgcaaacagccgagagaaact cgcaacacctgtgagtgctga

DBGET integrated database retrieval system