Neisseria animaloris: NCTC12227_01337 Help Entry NCTC12227_01337   CDS       T06907                                  Symbol hinT Name (GenBank) HitA protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism nani  Neisseria animaloris Brite KEGG Orthology (KO) [BR:nani00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:nani03016]     NCTC12227_01337 (hinT)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nani04147]     NCTC12227_01337 (hinT) Transfer RNA biogenesis [BR:nani03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     NCTC12227_01337 (hinT) Exosome [BR:nani04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NCTC12227_01337 (hinT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DcpS_C HIT Motif Other DBs NCBI-ProteinID:  VEJ21595 UniProt:  A0A1X3CJL5 LinkDB All DBs Position 1:1432367..1432690 Genome browser AA seq 107 aa AA seqDB search MTDCIFCKIVDKQIPAGIVYEDDDMLCFKDIRPAAPVHLLLIPKVHFDSLAHAKPEHEAL LGKMMMKVPQIAEANGLNNGFKTQINTGKGGGQEVFHLHIHIMGRPA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgactgactgtattttctgcaaaatcgtggataagcaaatccccgccggaatcgtgtat gaagacgacgacatgctgtgtttcaaagacatccgccctgccgcgcccgtgcatctgctg ttgattccaaaagtgcatttcgattcgctcgcgcacgctaagcccgagcatgaggcgttg ttgggcaaaatgatgatgaaagtgccgcaaatcgccgaagccaacggcctcaataatggc ttcaaaacccaaatcaacacaggcaaaggcggcgggcaggaagtgtttcacctgcatatc catattatggggcggcctgcctga

DBGET integrated database retrieval system