KEGG   Novosphingobium aromaticivorans: Saro_1718Help
Entry
Saro_1718         CDS       T00322                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase, class-II, active site
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nar  Novosphingobium aromaticivorans
Brite
KEGG Orthology (KO) [BR:nar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Saro_1718
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Saro_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored FAD_binding_2 AlaDh_PNT_C FAD_binding_3 Glutaredoxin DAO Thi4 NAD_binding_8 K_oxygenase baeRF_family10
Motif
Other DBs
NCBI-ProteinID: ABD26158
UniProt: Q2G7L5
LinkDB All DBs
Position
1805578..1807137
Genome map
AA seq 519 aa AA seqDB search
MPVLDAATTAQLKAYLGNLRRPIELVATLDDSPKSAEMRSLVEEIVAQSDKVSARFDGTG
ERVPSFAIRADEGRAQAVFAGLPMGHEFTSLILALLHVGGHPPKEDADLLDQVRGLEGPL
HFETFFSLTCQNCPDVVQALNIMAALNPNVSHVAIDGALFKDEVERRQIMAVPTVYLNGE
LFGSGRMDLAQIVAKLDTNASARAAEKIAAKEPFDVLVVGGGPAGAAAAIYAARKGIRTG
VVAERFGGQVLDTMGIENFISIQHTEGPKLAAQLEQHVKEYDVDVMNLQRATGLVPAGDD
GLHEVKLENGASLKAKTLILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVAHVTLIEFDNQLRADAVLQTKLRSLPNVTIVTSALTTEVLGD
GAKVTGLVYKDRETGQTHTVELEGIFVQIGLVPNTEWLKGAIDLSPRGEIEVDARGATSV
PGVFGAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRQG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttctcgacgccgccaccactgcccagctcaaggcctatctaggcaacctgcgc
cgtccgatcgaactggtcgcaacgctcgacgacagcccgaagtcggccgaaatgcgcagc
ctcgtcgaggaaatcgtcgcgcagtcggacaaggtttcggctcgtttcgacggcaccggc
gagcgcgtgccgagttttgccatccgcgcggacgagggcagggcgcaggccgtgttcgcg
ggccttccgatgggccacgaattcacttccctgatccttgcgctgctccatgtcggcgga
cacccgcccaaggaagacgccgacctgctcgaccaggtgcgcggcctcgaaggtccgctg
cacttcgagacgttcttctcgctcacctgccagaactgccctgacgtggtgcaggcgctg
aacatcatggcggcgctcaatccgaacgtcagccacgtcgccatcgacggcgcgctgttc
aaggatgaggtcgagcggcgccagatcatggccgtgccgaccgtttacctcaacggcgaa
ctgttcggttcgggccgcatggacctcgcccagatcgtggcgaagctggacaccaacgcc
tctgcccgcgctgccgagaagatcgcggcaaaggagcctttcgacgtgcttgtcgtcggc
ggcggtcccgcaggcgcggcggctgcgatctatgccgcgcgcaagggcatccgcactggc
gtcgtggccgaacgtttcggtggccaggtgctcgacaccatgggcatcgagaacttcatc
tccatccagcataccgaagggccgaagctggcggcgcaactggaacagcacgtcaaggaa
tacgacgtcgacgtgatgaacctccagcgcgcgaccgggctggtgccggcgggcgatgac
ggcctgcacgaagtgaagctggagaacggggcaagcctcaaggcgaagacgctgatcctg
tcgaccggcgcgcgctggaggcagatgggcgttcccggcgaggacgagtatcgcaacaag
ggtgtcgcctattgcccgcactgcgacggaccgttgttcaagggcaagcggacggctgtg
atcggtggcggcaactctggcgtggaagccgcgatcgaccttgccggcatcgtcgcccat
gtcacgctgatcgagttcgacaaccagcttcgcgccgacgccgtgctccagaccaagctg
cgctcgctgcccaacgtcaccatcgtcacgtcggcgctcacaaccgaagtcctcggtgac
ggggcgaaggtgacgggcctcgtctacaaggaccgcgagaccggccagacgcacacggtc
gaactggaaggcatcttcgtgcagatcggcctcgtgcccaacaccgaatggctcaagggc
gcgatcgatctcagcccgcgcggcgagatcgaggtcgatgcgcgcggcgcgaccagtgtg
cccggcgtattcggcgcgggcgatgcgacgactgtgccgtacaagcagatcgtcatcgcg
atgggcgagggttcgaaggctgcgctgtccgcattcgattaccttatccgacagggttga

DBGET integrated database retrieval system