KEGG   Nocardioides sp. JS614: Noca_0645Help
Entry
Noca_0645         CDS       T00443                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00250  Alanine, aspartate and glutamate metabolism
nca00280  Valine, leucine and isoleucine degradation
nca00410  beta-Alanine metabolism
nca00640  Propanoate metabolism
nca00650  Butanoate metabolism
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Noca_0645
   00650 Butanoate metabolism
    Noca_0645
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Noca_0645
   00280 Valine, leucine and isoleucine degradation
    Noca_0645
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Noca_0645
Enzymes [BR:nca01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Noca_0645
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Noca_0645
Amino acid related enzymes [BR:nca01007]
 Aminotransferase (transaminase)
  Class III
   Noca_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABL80171
UniProt: A1SED6
LinkDB All DBs
Position
684225..685583
Genome map
AA seq 452 aa AA seqDB search
MTAVSDEKPSKLSAVHQQRLLRTELPGPASRRLMARKSAAVAQGVGTTMPVFAANADGGV
VVDVDGNQFIDLGSGIAVTSVGASASRVVAAVQEQVAAFTHTCFMVTPYAGYVSVAEALN
RLTPGGHEKRTALFNSGAEAVENAVKIARSHTGRQAVVVFDHAYHGRTNLTMAMTAKNMP
YKHGFGPFAGEVYRAPLSYPYRDGGVGGATAAARAIDVIEKQVGTANLAAVVIEPIQGEG
GFIEPAAGFLPALVAWCRANAAVFVADEVQTGFARTGDWFACDREGVVPDLIVTAKGIAG
GLPLSAVTGRAEMMDAAHVGGLGGTYGGNPIACAAALASIETIEAEGLVARAREIEGLLL
GRLRAIEARDSRIGNVRGRGAMIAVELVRAGTDEPDPELAKAVAAAAHRQGVIVLTCGTY
GNVLRFLPPLSISDDLLNDAFDVLAATFEVTK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtatccgacgagaagcccagcaagttgtccgccgttcaccagcagcgcctg
ctgcgcaccgagcttcccgggccggcgtcgcgccggctgatggcgcgcaagtccgccgct
gtcgcgcaaggcgtcggcacgacgatgccggtctttgcggccaacgccgacggcggcgtc
gtggtcgacgtcgacgggaaccagttcatcgacctcggctcgggcatcgctgtcacgtcg
gttggcgccagtgcctcacgcgtggtcgccgccgtgcaggagcaggttgccgcttttacc
cacacctgcttcatggttaccccctacgcgggctacgtcagcgtcgccgaggcgctgaat
cggctcacccccggcggccacgagaagcgcaccgcgctgttcaactccggcgccgaggcc
gtcgagaacgccgtgaagatcgcgcgctcacacaccggccgccaggcggtcgtcgtcttt
gaccacgcctaccatggtcggaccaacctgacgatggcgatgactgcgaagaacatgcca
tacaagcacggcttcggtccgttcgccggcgaggtctaccgcgcgcccctttcctacccc
tatcgcgacggcggcgtcggtggtgcaacggctgcggcccgggccatcgatgtgatcgag
aagcaggtcggcaccgccaatttggccgctgtagtgatcgagccgatccaaggcgagggc
gggttcatcgagcctgctgcgggctttctgccggcccttgtggcctggtgccgcgcgaac
gcggccgtcttcgtggctgacgaggtgcagaccggcttcgcccgtaccggcgactggttc
gcgtgcgaccgtgaaggcgtcgttcccgatctcatcgtcacagccaagggcatcgccggc
ggcctgccgctctcagcggtcaccggccgtgcggagatgatggacgccgcccacgttggt
ggtctcggcggcacctacggcggcaatccgatcgcctgcgcggccgcgctcgcgtcgatc
gagaccatcgaggccgagggcttggtcgcccgggcccgcgagatcgaagggctcctcctc
ggccggctccgtgccatcgaggcccgcgactcccggatcgggaacgtccgcggtcgtggc
gccatgattgccgtcgagttggtccgggccggcaccgatgagccggaccccgagctcgcc
aaggccgttgccgccgcggcgcaccggcagggcgtcatcgtcctgacatgcggcacgtac
ggcaatgtgctccgcttcttgccgccgctctcgatctccgacgaccttctaaacgatgcc
ttcgacgtgctcgccgcgactttcgaggtgacgaagtga

DBGET integrated database retrieval system