Niveispirillum cyanobacteriorum: C0V82_06770 Help Entry C0V82_06770       CDS       T05262                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ncb  Niveispirillum cyanobacteriorum Pathway ncb00190   Oxidative phosphorylation ncb01100   Metabolic pathways Module ncb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ncb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C0V82_06770  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ncb00194]     C0V82_06770 Photosynthesis proteins [BR:ncb00194]  Photosystem and electron transport system   F-type ATPase [OT]    C0V82_06770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Tetraspanin Motif Other DBs NCBI-ProteinID:  AUN29962 UniProt:  A0A2K9NAD1 LinkDB All DBs Position eg_1:complement(1505786..1506010) Genome browser AA seq 74 aa AA seqDB search MEAEAAKFIGAGLAMLALLGVGIGLGNLFSGLYQAASRNPAALNSYKTFVFIGFALTEAT GLFALVIAFLILFA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaagctgaagccgcaaagttcatcggtgccggtctcgccatgctcgccctgctgggc gttggtatcggcctgggcaacctgttctccggcctgtatcaggctgcttcgcgtaacccg gccgctctgaactcctacaagaccttcgtcttcatcggcttcgcgctgaccgaagcgacc ggtctgttcgcgctggttatcgccttcctgatcctgttcgcctaa

DBGET integrated database retrieval system