KEGG   Notothenia coriiceps (black rockcod): 104951552
Entry
104951552         CDS       T04920                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ncc  Notothenia coriiceps (black rockcod)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 104951552
NCBI-ProteinID: XP_010776531
UniProt: A0A6I9NPX8
LinkDB
Position
Unknown
AA seq 366 aa
MSCGELIELRDLRTDRERIELTHGTHTPCSPPRLERANALRISPSKVPDLLSRAGIIRVL
SSTQDPDPTEENGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHHRCRDG
IRLDCSWDRGSVAEHACVVEHTIETDTNVDEQIEWGKQDLTTTDFQQKVKEYNAQINSNL
FMNMNKDGSYTGFIKVQFKLARPVSVTPPKKGGSDAGARKASGVKRRTSFYLPKDASKHL
HISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYIRKVSDNECPLRLRLCAGP
NEKVLSYVLKENETGEVNWHAFSMPELKNFQRMLQREEEEHVKQIVQRYALARTKMQDAL
AGSTPG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtcgtgtggggagctaatcgagctccgtgacctgaggacggacagagagaggattgag
ctgacacacggcactcacacaccctgctcgcctccacgcctggagagagccaacgccctg
aggatcagtccgagcaaggtaccagacctgctgagccgggcgggcatcatcagagtcctg
agcagcacccaggaccccgatcccactgaagagaacggagagggacacaacttccagccc
tgcagccacgctcagcccacatggtgcgacctgtgtggagacttcatctggggactgtac
aagcagagcctgcggtgtgtcaattgtagattcacatgccaccaccgctgtcgtgatggg
atccggttggactgcagctgggaccgaggctctgtggctgaacacgcatgtgtggtggag
cacaccatagaaacagacacaaatgtggatgaacagattgaatggggaaagcaagacttg
acgacaacagattttcagcagaaggtgaaggaatacaacgctcaaatcaacagcaatctg
ttcatgaacatgaacaaggatggttcctacacgggcttcataaaggtgcagtttaagttg
gcacgacctgtgtcagttacacctccaaaaaaagggggttccgatgctggagcgaggaag
gctagtggggtgaaacgccgcacgtcgttctacctgccaaaggatgcttccaagcacctg
cacattagctcacgcacttctgctcgggaggtcatcgaggctttgttgaaaaagtttact
gtggttgacaatcctggcaagtttgccctgtttgaacgcagcgagcgtcatgaccaagtt
tatattcgcaaggtatctgacaatgagtgtcccctccgcctgcgtctgtgtgctgggccc
aatgagaaagtcctcagctatgttctgaaagaaaatgaaactggagaagtcaattggcat
gccttctctatgcccgagttgaagaacttccagcgtatgctgcagcgtgaagaggaggag
cacgtgaagcagatcgtgcagcgatacgctctggcccgcactaagatgcaggacgctctg
gctggttcaactcccggttga

DBGET integrated database retrieval system