KEGG   Notothenia coriiceps (black rockcod): 104956066
Entry
104956066         CDS       T04920                                 

Definition
(RefSeq) multiple epidermal growth factor-like domains protein 8
  KO
K23664  multipile epidermal growth factor-like domains protein 8
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104956066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ncc04990]
    104956066
Domain-containing proteins not elsewhere classified [BR:ncc04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   104956066
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_5 Kelch_1 Kelch_6 CUB Kelch_2 EGF_2 hEGF
Other DBs
NCBI-GeneID: 104956066
NCBI-ProteinID: XP_010781807
UniProt: A0A6I9P0W4
LinkDB
Position
Unknown
AA seq 588 aa
MEAKRRELAVPVMASPLPVSIILVVLLLAESPCQAGDCKGHRQVLRGPPGYVTDGPGNYS
VNGNCEWLIKAPSSSHSIVLNFTFMDTECTYDYLFVYDGDSYQSPLLASLSGNTLPEPIE
AKSGKMLLHLFSDANYNLLGYNATFTFSLCPGACGGRGRCDSTTSKCQCHQGWGGAACTT
LLCSQACSVNGQCDKKGERCICNPGFLGQSCLLGFHNDSGAGQWWRVSEGNPHTPPRMGS
AGVYLSSTGAMYLFGGFDLNRALGDLIKYNFSSNQWESRSYGHSPVARHSHTAVEWTGNM
VIFGGELANGSLASDVWMYRPLQDDWQQHGFSNSRGSPKLANHAAAVVDNYLYVFGGRTE
EDMFSSSLYRFGLHGSGRWETVQPTGGKPPSTAGHSMVFHSPSRTLLVYGGHRPTTARFS
VRVNNTDVFHVDRRFWTSFRSRFPATGPRERAFHTATVIGNYMVVYGGNVHIHYQEEKCY
DEDIFFYHLGCHQWVSAGERWSLRGDPVRGRYSHVAAVMEGKVLLVAGGYNGIANGDLVA
YKVPLFVSSDQGDRDAVCAEALDESMCLKNPECSWCEGRCREYQPTNP
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggaggcaaagagacgggaactggcagtgccagtgatggcctcccccctgcctgtctcc
atcatcctggtggtcctgctcttggctgagtctccatgccaggcaggggactgcaaaggc
cacaggcaggtgttgaggggaccaccaggctacgtcacagatggaccaggaaactactct
gtcaatgggaactgcgagtggcttatcaaagcccccagcagcagtcacagcatagtccta
aatttcaccttcatggacacagaatgtacctatgactacctgtttgtgtatgatggagac
tcctaccagagccctcttctagccagcctgagtggcaacactctgcctgaacccattgaa
gccaagtctggcaagatgctgcttcatcttttcagtgacgctaattacaacctcctgggc
tataatgcaacgttcaccttctctctgtgccccggagcctgtgggggccgcggtcgctgt
gactccaccacttcaaagtgccagtgccatcagggttggggaggagcagcttgtacaacc
ctcctgtgctcccaggcttgttctgtgaatggccagtgtgacaagaaaggggagcgttgc
atatgtaaccctggcttcctgggtcagagctgcctgcttggttttcataacgacagtggg
gcggggcagtggtggcgggtgagtgaaggaaacccccacacgccccccaggatgggttct
gctggcgtgtatctgtcctccactggagccatgtacttgtttggcgggtttgacctgaat
agagctcttggtgacttgatcaaatataacttctcctccaaccaatgggaaagccggtct
tatggtcactctcctgtggctcgtcattcccacacagctgttgagtggacgggtaacatg
gtgatctttggaggagagcttgctaacggctccctggccagtgacgtctggatgtaccgg
cctctccaagatgactggcagcagcacggcttctcaaattcacgtgggtctcctaaactg
gccaatcacgctgcagctgtcgtagacaactatctctatgtatttggaggtcgcactgaa
gaggatatgttttcttcctctctgtatcggttcggcctgcatggctccggccggtgggag
actgttcagcccaccggggggaagcccccttccaccgcgggccactccatggtgttccac
agcccctccagaacgctgctggtctacggcggccaccggcccaccactgccaggtttagt
gtgagggtaaacaacaccgacgtgttccacgtggaccggcggttctggacatctttccgt
tcccgtttcccagcaaccggccccagagagcgagctttccacacagccaccgtcatcgga
aactacatggtggtctacggggggaatgtgcatattcattaccaagaggagaagtgctat
gatgaggatatcttcttttaccacctgggctgtcaccagtgggtttctgctggggagaga
tggtccctcagaggggatccagtgagggggcgttactcgcacgttgctgctgtgatggag
ggaaaagtgctgctggttgccgggggttacaacggtattgccaatggagacctggtggct
tacaaagttccgctgttcgtcagtagcgatcagggtgacagggatgctgtgtgtgctgag
gcgctcgatgaaagtatgtgcctgaagaaccccgagtgcagctggtgtgaaggccgctgt
cgagagtaccagcccactaatccg

DBGET integrated database retrieval system