KEGG   Notothenia coriiceps (black rockcod): 104957019
Entry
104957019         CDS       T04920                                 

Gene name
mcm7
Definition
(RefSeq) DNA replication licensing factor MCM7 isoform X1
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
ncc  Notothenia coriiceps (black rockcod)
Pathway
ncc03030  DNA replication
ncc04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ncc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104957019 (mcm7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104957019 (mcm7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ncc01009]
    104957019 (mcm7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ncc03032]
    104957019 (mcm7)
Enzymes [BR:ncc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     104957019 (mcm7)
Protein phosphatases and associated proteins [BR:ncc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104957019 (mcm7)
DNA replication proteins [BR:ncc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    104957019 (mcm7)
SSDB
Motif
Pfam: MCM MCM_OB MCM_N MCM_lid Mg_chelatase AAA_5 AAA_3 MCM_bind PIG-S AAA_lid_2 Sigma54_activat Mg_chelatase_C
Other DBs
NCBI-GeneID: 104957019
NCBI-ProteinID: XP_010782917
UniProt: A0A6I9P421
LinkDB
Position
Unknown
AA seq 727 aa
MARKDYAAEKDKCKRVLQEFYSEDDNGKKVFKYGAQLVALAHREQVALYVDLDDVAEEDP
ELVESICENAKRYMDLVADAVHELLPEYKERDIVAKDSLDVYIEHRLMMEQRGRDPADTR
DRRNQYPPELMRRFELYFKAPTTSKPKVVRDVRADSIGHLVNVRGIVTRASEVKPMMAVA
TYTCDQCGAETYQPIQSPTFIPLVMCPSQECVTNKSGGRLYLQTRGSKFVKFQELRIQEH
SDQVPVGNIPRSMSIYARGENTRLAQPGDHVAINGVFLPLLRTGFKQATQGLLSETYMEA
HSITLMNKSEDDELGDDDLSEEELRSITEEGFYEKLAGSIAPEIYGHEDVKKALLLLLVG
GVQQAPKGMKIRGNINVCLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMR
DPMTGEMTLEGGALVLADQGVCCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNA
RCSILAAANPAYGRYNPRKSIEANIQLPAALLSRFDLLWLIQDKPDADSDLRLAQHITYV
HMHSRQPPTHFTPIDMKLMRRYMAACKKRQPVVPESLADYITAAYVEMRKEARVSKDTTF
TSARTLLSILRLSTALARLRLMETVEKEDVNEAMRLMEMSKDSLQADKSSATRAQRPADV
IFSLVRELSSEGLAGKGGAGGVVRVTEAEQRCTSRGFTPAQFQEALEEYEELNVWQVNQA
RSRITFV
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggctcgtaaggattatgcggcagagaaagacaaatgcaaaagggtcctgcaggagttt
tattctgaggacgacaatgggaagaaggtgttcaaatatggagctcaacttgtggcgctg
gcccacagggagcaggtggctctctacgtggatctggacgatgtggccgaggaagacccc
gagcttgttgagagcatctgtgaaaacgccaagcgctacatggacctggtcgctgacgcc
gtccacgaactgctgccagagtacaaagaaagagatattgttgccaaggattctttggac
gtgtacattgagcacaggctgatgatggaacagaggggtcgcgaccctgcagacaccaga
gaccgtcgtaaccaatacccccctgaactcatgaggagattcgagctgtactttaaggct
cccaccacttctaaacccaaagtggttcgtgacgtgcgagcggacagcatcgggcatctg
gtgaacgttcgcggaatagtgactcgcgcctctgaagtcaaaccaatgatggctgtcgct
acgtacacatgtgaccagtgtggtgcggagacctaccaacctatccagtctcccaccttc
attcccctcgtcatgtgtcccagccaagagtgcgtcaccaacaaatctggagggcggctc
tacctgcagaccagaggctcaaagtttgtcaagttccaggagctgcgtattcaggaacac
agcgaccaggtgcccgtcggaaacattccacggagcatgtctatttatgcccgcggagaa
aacacacgtctcgcccagccaggagaccatgtagccatcaacggggtcttcctccctctt
cttcgcacagggttcaaacaggccactcagggtcttctgtcagaaacctacatggaggct
catagcatcacactcatgaacaagtcagaggacgacgagcttggcgatgatgatctgagt
gaagaggagctgcgcagcatcacagaggagggcttttatgagaagctagccggctcgata
gcaccagagatctatggacacgaggatgtaaagaaggctctgctcctgctgctggtgggg
ggggtgcaacaggctcccaaaggcatgaagatcagaggcaacataaacgtctgcctgatg
ggagaccccggagtggccaagtcccagctgctgtcctacatcgaccgcctggctcctcga
agtcagtacacgacgggtcgcggttcctccggtgtgggtctgactgcagcggtgatgcgt
gaccccatgaccggagagatgaccctggaaggaggagccctggtgctcgctgaccaggga
gtctgctgcattgacgagtttgataagatggccgacgctgaccggacagccatccacgag
gttatggagcagcagaccatctccatcgctaaggccggcatcatgacctccctcaatgcc
cgctgctccattctagcagccgctaaccccgcctacggccgttacaatcccaggaagagc
atcgaggccaacattcagcttcccgccgctctgctctcccgtttcgacctgctgtggctg
atccaggacaagccggacgccgactctgacctgcgtctggcccagcacatcacctacgtc
cacatgcactcccgccagccgcccactcacttcacccccatcgacatgaagctgatgagg
cgttacatggctgcgtgtaagaagcgtcagccggtggttcccgagtcgctggctgattac
atcaccgctgcctatgtagagatgaggaaggaggcccgagtcagcaaagacacgaccttc
acctccgcccgaaccctcctctccatcctgcgtctgtccactgccctggctcgccttcgc
ttgatggagaccgtggagaaggaagacgtcaacgaggccatgagactcatggagatgtcc
aaggattcacttcaagccgacaagtccagcgccacaagggctcagcgtccggccgacgtc
atcttctctctggtgcgagagctctcctccgagggcttggctggaaaaggtggcgcgggc
ggggtggtgcgagtgactgaagcagagcagcgttgcacctcccgtggcttcaccccagcc
cagttccaggaggcgctggaggagtacgaggagctgaacgtgtggcaggtgaaccaggcc
cgcagccgcatcaccttcgtctga

DBGET integrated database retrieval system