KEGG   Naumovozyma castellii: NCAS_0A12010Help
Entry
NCAS_0A12010      CDS       T02233                                 

Gene name
NCAS0A12010
Definition
(RefSeq) hypothetical protein
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00240  Pyrimidine metabolism
ncs00760  Nicotinate and nicotinamide metabolism
ncs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NCAS_0A12010 (NCAS0A12010)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NCAS_0A12010 (NCAS0A12010)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     NCAS_0A12010 (NCAS0A12010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 11526584
NCBI-ProteinID: XP_003674140
UniProt: G0V8G1
LinkDB All DBs
Position
1:2380758..2381771
Genome map
AA seq 337 aa AA seqDB search
MTISKIPIWLDCDPGHDDAIAILLACFHPAFKLLGVSACYGNSTPQNTYYNACSLLTAMG
KSIPVYRGAQKPWVRQAEYAPDIHGISGLDGTSLLPIPISTLEHDKTYLEAMEEAILTNE
GEISFLSTGCLTSTATLLRDKPYLKEKIKYISIMGGGFDIGNKNINCSAEFNIWADPHAA
NFVFHDPHVKDKCILVPLNLTHTAIATETIDKEILGDGSSNLRRLFFELFQYFRHTYKDL
QGFDQGPPVHDPLTLMPLLEFFGWSSHSDVQFDYKRMDINVVDDVWSPDAGRTYSIKDYP
KEGKTGTIVGLHLNIPFFWEQVLAALTEVDKTSTIEI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactatttcaaagataccaatatggcttgattgtgacccgggacacgatgatgcaatc
gctatacttctagcatgtttccatccagcatttaagcttttaggtgtcagtgcttgctat
ggtaactcgacgccacaaaacacatactacaatgcatgctcactattgactgcaatgggt
aaatctattcctgtataccgaggagcacagaaaccttgggttcgtcaggctgagtatgcc
ccagatattcatggaatatctggtttagacggtacctcattacttcctatacccatatcc
acattagagcacgacaagacatatctggaagcaatggaagaagcaatacttacaaacgaa
ggagaaatttcgtttctctcgaccggttgtttgacatctaccgctacattactaagagac
aaaccatatttgaaagagaaaatcaaatatattagtataatggggggtggatttgatatt
ggcaacaagaatattaactgttcggcagagttcaatatatgggcagacccacacgcagcc
aactttgtatttcatgacccccacgttaaagataaatgtattctggtgcctttgaatcta
acgcatacagcaattgctacggaaacgatagacaaagagattctgggagacggctcatct
aacttaaggcgattattctttgaattgtttcaatatttccgccacacttataaggatcta
caaggttttgatcaaggtccaccagttcatgatccattaaccctaatgcctctattagag
ttttttggatggagttcacattctgatgttcaattcgactataaacgaatggatattaat
gttgtggatgatgtgtggagtccggatgctggtcgcacctattcaataaaagattatcca
aaagagggaaaaactggaactatcgttggtttgcatttaaacataccctttttttgggaa
caagtcttagctgcactaacggaagtagataaaacgtcaacaattgagatttaa

DBGET integrated database retrieval system