KEGG   Naumovozyma castellii: NCAS_0C05870Help
Entry
NCAS_0C05870      CDS       T02233                                 

Gene name
NCAS0C05870
Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00020  Citrate cycle (TCA cycle)
ncs00190  Oxidative phosphorylation
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
ncs01200  Carbon metabolism
Module
ncs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ncs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ncs_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCAS_0C05870 (NCAS0C05870)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCAS_0C05870 (NCAS0C05870)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NCAS_0C05870 (NCAS0C05870)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer2 Fer4_9
Motif
Other DBs
NCBI-GeneID: 11527839
NCBI-ProteinID: XP_003675941
UniProt: G0VDL5
LinkDB All DBs
Position
3:1210742..1211539
Genome map
AA seq 265 aa AA seqDB search
MNGLLLRRNVFNRLTIGVRGLASTTQATQPRMKTFKVYRWNPDQPTEKPHLQSFQVDLNS
CGPMVLDALLKIKNEQDSTLTFRRSCREGICGSCAMNIGGRNTLACLCKIDQNESKQLKI
YPLPHMYVVKDLVPDLTNFYQQYKSIQPYLQRSSYPEDGKEVLQSIEDRKKLNGLYECIL
CACCSTSCPSYWWNQEEYLGPAVLMQAYRWLIDSRDQATKARKTMLENSMSLYRCHTIMN
CTKTCPKGLNPGFAIAKIKKSLAMM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtttactcctaagaagaaacgtatttaatagattaacaattggcgtcaggggg
ctcgcttccactacccaggccacacaacctagaatgaagactttcaaggtttatagatgg
aatcctgatcaaccaactgaaaaaccacatttgcaatctttccaagtggatttaaatagt
tgtggccccatggtcttggatgctcttttaaagattaagaatgaacaagattccactttg
acctttagaagatcatgtagagaaggtatttgtgggtcatgtgctatgaatattggtggt
agaaatacattggcttgtctttgtaagattgatcaaaatgaatccaaacaattgaaaatc
tatccattacctcacatgtacgttgttaaagatttagtccctgatttgaccaatttctac
caacagtacaaatccattcaaccttatcttcaaagatcttcttatcctgaagatgggaag
gaagtcttacaatctatcgaagatcgtaagaaattgaatgggttatatgaatgtatctta
tgtgcttgttgctccacttcgtgtccttcatattggtggaaccaagaagaatatttgggt
cctgctgtcctaatgcaagcataccgttggttgatagattcaagagatcaagctactaag
gcaagaaagacaatgttggaaaattcaatgtccctttatagatgtcataccattatgaat
tgtacaaagacttgtccaaagggtttgaatccaggttttgccattgctaagattaagaag
agcttggctatgatgtga

DBGET integrated database retrieval system