KEGG   Nitrospira defluvii: NIDE1973
Entry
NIDE1973          CDS       T01281                                 

Definition
(GenBank) conserved membrane protein of unknown function, IcmF-related
  KO
K11891  type VI secretion system protein ImpL
Organism
nde  Nitrospira defluvii
Pathway
nde03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nde00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NIDE1973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nde02044]
    NIDE1973
Secretion system [BR:nde02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NIDE1973
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: CBK41697
UniProt: D8PEN8
LinkDB
Position
1882727..1886356
AA seq 1209 aa
MIGIFSKIRSIVVAILRHPRLVIEFGVVCLIWLVWLIGPQIGLESVESRVQVIIVIGLLR
FVFYIVHHLVSQRRATQLEASLQQQAQLQVAAARADHKEELEALRRQFDKGVAALKESTI
GKGLKGKAALYALPWYMFIGPPASGKSTALRHSGLQFPYLGESGQGLQGMGGTRNCDWWF
TNDAVLLDTAGRYVTHEEDQKEWLGFLDLLKRCRKEKPINGILAAISIADLMQASEEELE
AHAKKIRSRVDELMTHLGITFPVYLIFTKCDLVRGFVEFFEELTKTEREKIWGCTFSKSS
AKEPAHVRFKAEFDQLLAAVKSRRLARLVNARGPYKLNIFTFPLQLASATDKLNHFVDVL
FQSNPYQENPMFRGFYLTSGTQEGAPIDRILGAISRASGLGEMVASMFSPAETKSYFLKD
LFTEVIFPDHFLAGPTTTIHKQRGFLRVASFAAATVFIAISVVALAWSYVGNKALVSSTL
SAALNAPDVALTDAASLERNTEYLDKLGDRFDELLSYTQNGAPLRLWGFYRGERLLDDLQ
EVYARQFEKIFLIPTKRYMEDELYRFTAGDVPRTTAHSSDYYYAMLKAYIMLGEPKRVST
AYLERWLTAHWSEQLSRLYATYAVPDWVQSSIKRHMILYARYLARVQQGRVELNKHLVAS
VQEQLRDIPIVERLYGLSLREIDESLRPFSVETALQGSHQGSVVSDYIVPGVFTLEGWKG
PFQSAMTRVLEGLGNEAWVIGEPDTKQVDLERGIKKLYFQDYVLHWRAFLKSLKLGPAVT
PANMEELLSTLSQTDSPVMRILEAVDHNTVPEPEGIAKLQDTAAGLLGKVKEKLGLESVG
KKFEKTKRDPDTAEFPGGVTIHFLAMHNLIAAQKDAKEEAPFIQYLAELRKAHQVFRPLL
RSETVGPDTKTLAKSIVAGEPNDLLQGVIKTDALLQKLDTELRESMLAVLSEPWLMTMRG
VLERTRSDIDRRWGADVFQACQRTIEGKFPFRASGEDAVVADVVDFFHPSNGTLWRFYQA
ELKAFMEESGERLVRKAWNGIGMTFSDAFLESMERARFISDGLFTKGSPDLGTVLEVYPY
PPQGFAGRTVTEVRLDVGGQPLRYRMEPQEWWEMKWPGPTPSAGATLLVQVGNTWVTREY
KDVWGLFKLMNAGSVETADHSEVMVKVRWELQSPDAKPLQVRYDVKGRSARNPFRSGFFE
QFNCAQHLM
NT seq 3630 nt   +upstreamnt  +downstreamnt
gtgatcggaatcttttcgaagataaggtcgatcgtggtggccatactccggcatccgcgt
ttggtgatcgagttcggagtggtctgtctgatttggctggtgtggttgatcgggccccag
ataggtctggaatcagtcgaaagccgagtacaggtgatcatcgtcatcggcctgcttcgg
ttcgtgttctatatcgttcaccatctcgtctcgcagcgccgtgccacccaattggaggca
tcgcttcaacagcaagcgcaactacaggtggcggcggccagagcagatcataaggaggag
ctggaagcgctgcgtcgccagttcgataagggcgtggcggcgttgaaagagtccaccatc
ggaaaggggcttaaggggaaagcggctctctatgcgttgccctggtatatgttcatcggc
ccgcctgcgtcgggaaagagcacggccctgcggcattccgggttgcagtttccctatctc
ggcgaatccggacagggacttcagggcatgggaggcacgagaaactgcgattggtggttt
accaatgacgccgtcctgctggacacggccggtcgctatgtcacgcatgaggaagatcag
aaagaatggctgggctttctcgatctgttgaagcgatgtcggaaggagaaacccatcaac
ggaatccttgcggcgatcagtatcgctgatctgatgcaggccagcgaagaagagttagag
gctcatgccaagaaaattcgcagccgggttgatgaattgatgacacatctcgggatcacc
tttcccgtctatctcatttttaccaagtgtgacttggtgaggggctttgttgaatttttt
gaggagctgaccaagaccgaacgggagaaaatctggggctgtaccttctccaagagttcc
gccaaggaaccggcgcatgtgcgctttaaggccgagtttgatcagttgctcgccgccgtg
aaatccaggcggctcgcgcgcctcgtgaacgcgcggggaccgtacaagctcaatattttc
acgtttcctctccagctcgcctctgcgaccgacaagttgaaccattttgtggacgtgttg
tttcaatcaaatccctatcaggaaaatccgatgttccggggattctatttgacgagcggg
acacaggagggcgcaccgattgatcggatcctgggggccatcagcagggcttccggactc
ggagagatggtcgcctcaatgttctcgccggcagagacaaagagctatttcctgaaggac
ctctttaccgaagtgatctttcccgatcactttctggccgggcctacgactaccatacac
aagcaacgggggttcctgcgtgttgcctcctttgccgcggcgacggtgtttatcgcaatc
tccgtcgtcgcactcgcatggtcgtatgtcggaaacaaggcgctggtcagcagtaccttg
tccgcagcgttgaatgcccccgacgtcgcattgacagatgcggcaagtcttgaaaggaac
acggagtaccttgataagctgggcgatcgtttcgacgagcttctttcctatacccagaac
ggcgcacctctgcgtttatggggtttttatcgtggcgagcgtcttcttgacgatcttcag
gaggtctatgcgagacagttcgagaagatcttcctcattcccaccaagcgctatatggaa
gacgagttatatcggtttacggcaggagacgtccccagaacgacagcgcattcgagtgat
tattactacgccatgctcaaggcgtacatcatgctgggtgagcccaaacgtgtgagcacc
gcatacctggagcggtggctgacggcgcactggagcgagcagctgagccgtctgtatgcg
acctatgctgttccggactgggtgcaatcaagtatcaagcggcacatgatcctctatgcc
aggtatctggcccgagtgcagcagggacgggtcgaattaaataagcacctcgtggcaagt
gtgcaggaacagttgcgcgatattcccatcgtggaacgtctctacggcctcagtcttcgt
gaaatcgacgaatcgttgcgccccttctcggtggaaaccgcacttcagggcagtcatcaa
ggtagtgtggtcagcgactatattgtcccgggggtgttcaccttagaggggtggaagggg
ccgtttcagagtgcaatgacgcgggtgctcgaaggtctaggaaatgaagcctgggtcatt
ggtgagcctgatacgaaacaagtcgatctcgagcgggggatcaagaagctgtattttcag
gattatgtgcttcattggcgggcattcctcaagtcactgaaactcgggccggccgtcact
ccggcgaatatggaagaattgctctcaacgctgagccagacagattcacctgttatgaga
atattggaagcggtcgaccacaacaccgtgcctgagccggaaggcatcgcaaaactccag
gacaccgctgccggcctgttgggaaaggtcaaagagaagttagggttggaatccgtcggc
aagaaatttgagaagacaaaaagagacccggataccgctgagtttcccggcggggtgacc
atacacttcctcgccatgcataacctgatcgcggcccagaaggatgcgaaagaggaggct
ccctttatccaatatctggcagagttacgaaaggcgcatcaggtgtttcgaccacttctc
cgttcggagaccgtcgggccggacacgaaaacccttgcgaagagcattgtggcgggagag
cccaacgaccttctgcaaggagtcattaaaacggacgcgttgctgcagaagctggatact
gaattgcgtgaatcgatgttggcagtgctgtccgagccatggttgatgaccatgcgaggt
gtgctggagcgaactcgatcggatatcgatcgacgctggggcgccgacgtatttcaggcc
tgtcaacggacgattgaagggaagttcccatttcgcgcgtcaggcgaggatgcggtcgta
gccgacgtcgtggacttctttcacccctccaatggcaccctgtggcgtttttaccaggca
gagctcaaggcgtttatggaggagagcggtgaacggctggttcgcaaggcttggaacgga
atcgggatgaccttttcggatgcgttcttagagtcgatggagcgggccagatttatttca
gatggactttttacaaaaggctctcccgatctgggaacagtcctagaggtctatccatac
ccgccacagggatttgccggtcgaacggtcaccgaggtgcgactggatgtgggcggtcaa
ccgctgcgttatcgcatggaaccacaagaatggtgggagatgaaatggcctgggcccaca
ccctcagccggagccacgctgcttgtccaggtgggcaacacctgggtcacgagggagtac
aaagatgtctggggactcttcaaacttatgaatgccgggtcggttgagacggccgatcat
agtgaggtcatggtcaaggtccgatgggaactgcagtccccggatgcaaagccgttacag
gttcggtatgacgtgaagggccggagcgccaggaatccattccgttccggattttttgag
cagttcaactgcgcgcagcacctcatgtga

DBGET integrated database retrieval system