KEGG   Naumovozyma dairenensis: NDAI_0J01040Help
Entry
NDAI_0J01040      CDS       T02234                                 

Gene name
NDAI0J01040
Definition
(RefSeq) hypothetical protein
  KO
K13341  peroxin-7
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NDAI_0J01040 (NDAI0J01040)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 11494176
NCBI-ProteinID: XP_003672239
UniProt: G0WGR8
LinkDB All DBs
Position
10:238940..240136
Genome map
AA seq 398 aa AA seqDB search
MLRYHINGFSGYNIQYSPFFDNKLAVASASNYGLVGNGKLVILDILPDGTIKESNSFLTQ
DCLFDVAWNESHESQCLVAQGDGSLRLFDINLQKYPIAIFKEHKKEVLSCNWNLINKNLF
LSSSWDGDVKVWSTARQASLITLSPIHTDPTAIVNTKSNINPSLNNVSQPILHPRSTAIR
QPVTSASMQGNDNKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSG
YETLTLDFNKYRSHIIATSGVDKAIKMWDMRFIPSTFSPQSTSTTPILSRRQQEPINEII
NAHDLAVKTIKWSPHHSNLMVSTSYDMTCKTWMDISYQNGTSNGRTNSLDPQRRNGCLAI
MDKHSEFAFGVDWSLWGQPGFIASTGWDGNVFIWNTLR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttaagataccatatcaatggatttagcggttacaatattcaatattccccctttttc
gataataagcttgcagttgcctcagcatctaattatggtcttgtaggaaacgggaagctg
gtcatattggatatattacctgatggaaccataaaggaatccaattctttcctaactcaa
gactgtttgttcgatgttgcttggaacgaatctcacgaatcacaatgtctagtggctcaa
ggagatggttcattgagattattcgatataaatcttcaaaaatatcccattgccatcttt
aaagaacataaaaaggaagtgttaagctgcaattggaatttgatcaataagaatttgttc
cttagtagttcatgggatggagatgttaaagtttggtcaacagcaagacaagcaagttta
ataacgttatcgccaattcatactgatcctactgctattgtaaacacgaaaagcaatatt
aatccatctttgaacaatgttagccagccaattcttcatcctagatcaacagctatacgg
caacctgtaacatcagcatcaatgcagggaaatgacaataaaaactgtatataccaagcc
caattttcaccacatgatcctaacatagtagcgtgttgttcaggtacttcatatcttact
cttttcgatcttcgacagccaacaccaaacgtacaaagaggtatcttaacacaaagtgga
tatgaaacattgacgctagatttcaataagtacagatcacatataattgctacatcaggt
gtagataaagcgattaaaatgtgggatatgaggtttattccttccacattttctcctcaa
tctacatctacaactccaatattatcaagacgacaacaagaacccattaatgaaattatc
aacgcacatgatttggctgtaaagacaattaaatggtcaccacatcattccaatttgatg
gtatctacttcatatgacatgacatgtaagacatggatggatatttcataccaaaatggt
acaagtaatgggaggacgaattcattggatccacaacgaagaaatggttgtttagcgatt
atggataaacattctgagtttgcgttcggggtagattggagtctttggggacagcctgga
tttatcgctagtactggttgggatggtaatgtcttcatttggaatactcttcgataa

DBGET integrated database retrieval system