KEGG   Nocardioides dokdonensis: I601_2861Help
Entry
I601_2861         CDS       T04431                                 

Gene name
davT_2
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ndk  Nocardioides dokdonensis
Pathway
ndk00250  Alanine, aspartate and glutamate metabolism
ndk00280  Valine, leucine and isoleucine degradation
ndk00310  Lysine degradation
ndk00410  beta-Alanine metabolism
ndk00640  Propanoate metabolism
ndk00650  Butanoate metabolism
ndk01100  Metabolic pathways
ndk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ndk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    I601_2861 (davT_2)
   00650 Butanoate metabolism
    I601_2861 (davT_2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I601_2861 (davT_2)
   00280 Valine, leucine and isoleucine degradation
    I601_2861 (davT_2)
   00310 Lysine degradation
    I601_2861 (davT_2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I601_2861 (davT_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ndk01007]
    I601_2861 (davT_2)
Enzymes [BR:ndk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     I601_2861 (davT_2)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     I601_2861 (davT_2)
    2.6.1.48  5-aminovalerate transaminase
     I601_2861 (davT_2)
Amino acid related enzymes [BR:ndk01007]
 Aminotransferase (transaminase)
  Class III
   I601_2861 (davT_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANH39277
UniProt: A0A1A9GLS2
LinkDB All DBs
Position
2993095..2994462
Genome map
AA seq 455 aa AA seqDB search
MNTPSTAAHPPVVEAGPRPTQERRLVTAIPGPRSQELQRRKERAVSRSVGTVLPVYVEAA
GGGVVVDVDGNSLIDLGSGIAVTTVGNAHPRVVQALAAQAAAFTHTCFMVTPYDGYVEVA
EALNRLTPGAHEKRSVLFNSGAEAVENAVKIARAHTGRQAVVTFDHAYHGRTNLTMAMTA
KNMPYKHGFGPFAAEVYRAPMSYPFRDGLPGPEAARRALDVIDKQVGAENLAAMVIEPIQ
GEGGFIVPASGFLAALAQWCRQHGVVFVADEVQTGFARTGAMFACDHEDVVPDLVVTAKG
IAGGMPLAAVTGRAEIMDAPHVGGLGGTYGGNPVACAAALAVLATIEEEQLVERARRIGA
SLTERLTALQAADPRLGEVRGRGAMIALEVVEPGTLEPDADLTRRVAAAAHAAGLIVLTC
GTWGNVLRFLPPLAMPDHLLVEALDVLEAIFEETR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgccgagcaccgccgcccacccacccgtggtcgaggcagggccccgcccgacc
caggaacgtcgcctggtcaccgcgatccccggtccccgctcccaggagctgcagcgccgc
aaggagcgtgcggtcagtcgatcggtcggcacggtgctgccggtctacgtcgaggccgcc
ggtgggggagtcgtcgtcgacgtcgacggcaactccctgatcgacctcggctccggcatc
gcggtgaccaccgtgggcaatgcccacccgagggtggtgcaggcgttggccgcccaggcg
gccgccttcacccacacctgcttcatggtcacgccgtacgacgggtacgtggaggtggcc
gaggcgctgaaccggctgacaccgggggcccacgagaagcgctcggtgctgttcaactcc
ggcgccgaggcggtggagaacgccgtgaagatcgcccgggcccacaccggccggcaagca
gtggtgaccttcgaccacgcctatcacggacggacgaacctgacgatggcgatgactgcg
aagaacatgccctacaagcacgggttcggaccgttcgccgccgaggtctatcgggcgccg
atgtcctacccgttccgcgacgggctccccggaccggaggccgcgcgccgtgcgctcgac
gtgatcgacaagcaggtgggagcggagaacctggccgcgatggtgatcgagccgatccag
ggcgagggcgggttcatcgtgccggcgtcgggcttcctggccgcgctcgcccagtggtgc
cgccagcacggagtggtgttcgtcgccgacgaggtgcagaccgggttcgcgcgcaccggg
gcgatgttcgcctgcgaccacgaggacgtggtgcccgacctggtcgtcaccgcgaagggc
atcgcgggcggcatgccgctggccgcggtgaccgggcgcgccgagatcatggacgcgccc
cacgtgggcggactcggcggcacgtacggcggcaacccggtcgcctgcgccgccgccctc
gcggtcctcgccaccatcgaggaggagcagctcgtcgagcgtgcccgtcggatcggcgcg
agcctgaccgagcgactcaccgcactccaggccgcggacccgcggctgggcgaggtccgt
ggacgcggcgcgatgatcgctctcgaggtggtcgagcccggcaccctcgagccggacgcg
gatctcacccgacgggttgcagccgctgcgcacgcggcgggcctgatcgtgctgacctgc
gggacgtggggcaacgtgctgcggttcctgccgccgctcgccatgcctgatcacctgctg
gtcgaggccctcgacgtgctcgaggccatcttcgaggagacccggtga

DBGET integrated database retrieval system