KEGG   Nonlabens dokdonensis: DDD_1451
Entry
DDD_1451          CDS       T02441                                 

Definition
(GenBank) hypothetical protein
Organism
ndo  Nonlabens dokdonensis
SSDB
Motif
Pfam: Lipase_GDSL_2
Other DBs
NCBI-ProteinID: AGC76578
UniProt: L7WCE1
LinkDB
Position
1555578..1556300
AA seq 240 aa
MKKLLVLSCYLCIISGCSDTLDKYEFQNMVPSKSLIHELKSSKEKIKGAQDTDELVIKIQ
FHGQSIVKGIKEKRIKSTLENAFPHVEFNITNTARSGFQVPRLLPLMESDIYPEQADVLF
FHAYGGTETGELDQFLKNLKINFKGDVIIFNHHLSFPDDPEQNQKLTKLENHTSVKIEKL
ANYYGFGFIDMRSEWATFIRLNKSITAGNLLRDGIHPNEEGKLILEHILMTHFIDAINTI
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaaaaagctactagttttatcgtgttatttatgtatcatttcaggttgctctgatact
ttagataaatatgaatttcaaaatatggtgccatcaaaaagcttgatccatgaattgaaa
agctctaaagaaaaaataaaaggtgcccaagatacagatgaactggtaattaaaatacag
tttcatggtcaatcaatagtaaaaggcatcaaagaaaaacgtataaaatcaactcttgaa
aatgctttccctcatgttgagtttaatattaccaacactgctcgtagtggatttcaagta
cctcgattactgcctttgatggaaagcgatatttatccagaacaggcagatgtacttttt
tttcatgcttatggaggtacagaaactggtgaattagatcaattccttaaaaacctaaaa
attaactttaaaggcgatgtgatcatatttaatcaccatctatcttttccagatgatcca
gaacaaaatcaaaaacttactaaattagaaaaccatacatcagtaaaaatagaaaaactc
gcaaattactacggatttggttttatagatatgagaagcgagtgggctacctttattagg
ctaaataagagcattacagcaggtaatttattaagagatggaattcaccctaacgaagaa
ggtaaattaatcttagagcacatactaatgacacatttcatagatgctataaatactatc
tag

DBGET integrated database retrieval system