KEGG   Nocardia farcinica IFM 10152: NFA_42410Help
Entry
NFA_42410         CDS       T00207                                 

Gene name
pfkA
Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00010  Glycolysis / Gluconeogenesis
nfa00030  Pentose phosphate pathway
nfa00051  Fructose and mannose metabolism
nfa00052  Galactose metabolism
nfa00680  Methane metabolism
nfa01100  Metabolic pathways
nfa01110  Biosynthesis of secondary metabolites
nfa01120  Microbial metabolism in diverse environments
nfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFA_42410 (pfkA)
   00030 Pentose phosphate pathway
    NFA_42410 (pfkA)
   00051 Fructose and mannose metabolism
    NFA_42410 (pfkA)
   00052 Galactose metabolism
    NFA_42410 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    NFA_42410 (pfkA)
Enzymes [BR:nfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NFA_42410 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     NFA_42410 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAD59090
NIH_Japan: nfa42410
UniProt: Q5YRV1
LinkDB All DBs
Position
complement(4390165..4391199)
Genome map
AA seq 344 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTANGRYGDAIVGFQDGWRGLLEDRKINILNDDRTDR
LLNKGGTMLGTARTNPDVLRAGLGKIKQTLDDNGIEALIPIGGEGTLTAASWLSDEGVPV
VGVPKTIDNDIDCTDVTFGHDTALSIATEAIDRLHTTAESHQRVMLVEVMGRHAGWIAVN
SGMAAGAHLTLVPEEPFDVDEVCTMIKRRFQRGDKHFICVVAEGSHPAPDSGFTLREGGV
DEFGHERFTGVAQQLGTEIERRIGKEVRTTVLGHVQRGGSPTPYDRVLATRFGLHAAEAV
HAGHFGQMVALHGTAIELVPLAEATKQLKRVPTERYREAQAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagtcttgaccggaggcggggactgtccaggactgaacgcggtcatccgc
gctgtcgttcgtaccgcgaacggccgctacggtgacgcgatcgtgggattccaggacggc
tggcgcggcctattggaagaccgcaagatcaacatcctcaacgacgaccgcaccgaccgg
ctgctcaacaagggcggcaccatgctcggcaccgcgcgcaccaaccccgacgtgctgcgc
gccgggctcggcaagatcaaacagacgctcgacgacaacggcatcgaggcactcatcccg
atcggcggcgagggcaccctcaccgcggccagctggctctccgacgagggggtgccggtg
gtcggcgtccccaagaccatcgacaacgacatcgactgcaccgatgtcaccttcggccac
gacaccgccctgagcatcgccaccgaggccatcgaccggctgcacaccaccgccgaatcg
caccagcgcgtgatgctggtcgaggtgatgggcaggcacgcgggctggatcgcggtcaac
tcgggcatggccgcgggcgcccacctcaccctggtgccggaggaacccttcgacgtcgac
gaggtgtgcacgatgatcaagcggcgcttccagcgcggcgacaagcatttcatctgcgtg
gtggccgagggctcgcatcccgcgcccgattccgggttcaccctgcgcgagggtggtgtc
gacgagttcggccacgagcggttcaccggcgtggcgcaacagctgggcaccgagatcgag
cgccgcatcggcaaggaggtgcgcaccaccgtcctcggtcacgtgcagcgcggcggcagc
cccaccccctacgaccgggtactggcgacccgcttcggcctgcacgccgccgaggccgtg
cacgccggacatttcggccagatggtcgcgctgcacggcaccgccatcgaactggtgccg
ctggccgaggcgaccaagcagctcaagcgcgtgcccaccgagcggtaccgggaggcgcag
gcgttcttcgggtga

DBGET integrated database retrieval system