KEGG   Nocardia farcinica NCTC11134: ERS450000_05669Help
Entry
ERS450000_05669   CDS       T04524                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00010  Glycolysis / Gluconeogenesis
nfr00030  Pentose phosphate pathway
nfr00051  Fructose and mannose metabolism
nfr00052  Galactose metabolism
nfr00680  Methane metabolism
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr01120  Microbial metabolism in diverse environments
nfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERS450000_05669 (pfkA)
   00030 Pentose phosphate pathway
    ERS450000_05669 (pfkA)
   00051 Fructose and mannose metabolism
    ERS450000_05669 (pfkA)
   00052 Galactose metabolism
    ERS450000_05669 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    ERS450000_05669 (pfkA)
Enzymes [BR:nfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ERS450000_05669 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ERS450000_05669 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CRY83758
UniProt: A0A0H5P8J3
LinkDB All DBs
Position
p2:2343748..2344782
Genome map
AA seq 344 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTANGRYGDAIVGFQDGWRGLLEDRKINILNDDRTDR
LLNKGGTMLGTARTNPDVLRAGLGKIKQTLDDNGIEALIPIGGEGTLTAASWLSDEGVPV
VGVPKTIDNDIDCTDVTFGHDTALSIATEAIDRLHTTAESHQRVMLVEVMGRHAGWIAVN
SGMAAGAHLTLVPEEPFDVDEVCTMIKRRFQRGDKHFICVVAEGSHPAPDSGFTLREGGV
DEFGHERFTGVAQQLGTEIERRIGKEVRTTVLGHVQRGGSPTPYDRVLATRFGLHAAEAV
HAGHFGQMVALHGTAIELVPLAEATKQLKRVPTERYREAQAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagtcttgaccggaggcggggactgtccaggactgaacgcggtcatccgc
gctgtcgttcgtaccgcgaacggccgctacggtgacgcgatcgtgggattccaggacggc
tggcgcggcctattggaagaccgcaagatcaacatcctcaacgacgaccgcaccgaccgg
ctgctcaacaagggcggcaccatgctcggcaccgcgcgcaccaaccccgacgtgctgcgc
gccgggctcggcaagatcaaacagaccctcgacgacaacggcatcgaggcgctcatcccg
atcggcggcgagggcaccctcaccgcggccagctggctctccgacgagggggtgccggtg
gtcggcgtccccaagaccatcgacaacgacatcgactgcaccgatgtcaccttcggccac
gacaccgccctcagcatcgccaccgaggccatcgaccggctgcacaccaccgccgaatcg
caccagcgcgtgatgctggtcgaggtgatgggcaggcacgcgggctggatcgcggtcaac
tcgggcatggccgcgggcgcccacctcaccctggtgccggaggaacccttcgacgtcgac
gaggtgtgcacgatgatcaagcggcgcttccagcgcggcgacaagcatttcatctgcgtg
gtggccgagggctcgcatcccgcgcccgattccgggttcaccctgcgcgagggcggtgtc
gacgagttcggccacgagcggttcaccggcgtggcgcaacagctgggcaccgagatcgag
cgccgcataggcaaggaggtgcgcaccaccgtcctcggtcacgtgcagcgcggcggcagc
cccacgccctacgaccgggtactggccacccgcttcggcctgcacgccgccgaggccgtg
cacgccgggcatttcggccagatggtcgcgctgcacggcaccgccatcgaactggtgccg
ctggccgaggcgaccaagcagctcaagcgcgtgcccaccgagcggtaccgggaggcgcag
gcgttcttcgggtga

DBGET integrated database retrieval system