KEGG   Nothobranchius furzeri (turquoise killifish): 107376930
Entry
107376930         CDS       T05163                                 

Gene name
epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107376930 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nfu04052]
    107376930 (epo)
Cytokines and growth factors [BR:nfu04052]
 Cytokines
  CSF and other factors
   107376930 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 107376930
NCBI-ProteinID: XP_015801743
LinkDB
Position
sgr04
AA seq 185 aa
MLRKTCKGLIALLLIVLEWTCPGLPSPPRPICDLRVLNHFIQEARDAEVAMKSCRDGCGL
TELVSVPQTTVNFDDWERKNATEQAQEVQTGLWLLHQALGLLQASMTDVDLNNHIDNSIR
NLLSINAVLRSLNIQEYTPPTSAVGLEGTWKVSSVAEVLQVHVNFLRGKVRLLLVGAEAC
QQDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcggaaaacttgtaaaggactgattgccttgctgttaatagtgttggagtggacc
tgtccaggcctaccatccccaccaaggccaatctgtgacctgcgggtcctgaaccatttc
atccaggaagcacgagacgcagaagttgcaatgaagtcttgtagggacggatgtggcctg
acagagttggtctctgttccccaaaccactgttaactttgatgactgggaaaggaaaaat
gcaacggagcaagcccaggaagtccagactggcttgtggcttttacatcaggccctcggc
ttactacaggcatcgatgacggatgtagacctaaacaatcacatagacaacagtataaga
aacctgcttagcattaacgctgtgctgcgaagcctaaacattcaggaatacaccccaccg
accagcgcagtgggactggagggaacgtggaaggtgtcctcggtggcagaagtcctccaa
gttcatgtgaactttctgcgaggcaaagtgcgccttctccttgtgggtgcagaggcttgt
cagcaagatgtcagctga

DBGET integrated database retrieval system