KEGG   Nothobranchius furzeri (turquoise killifish): 107385762
Entry
107385762         CDS       T05163                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04012  ErbB signaling pathway
nfu04068  FoxO signaling pathway
nfu04110  Cell cycle
nfu04115  p53 signaling pathway
nfu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107385762
   04068 FoxO signaling pathway
    107385762
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107385762
   04115 p53 signaling pathway
    107385762
   04218 Cellular senescence
    107385762
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107385762
NCBI-ProteinID: XP_015815346
UniProt: A0A1A8A266
LinkDB
Position
sgr10
AA seq 169 aa
MCRGMATLHKRALSTLRRNGPPRRSLFGPVDREQLQMEYRTALRKDLEEASQRWGFDFFS
DKPLESGDFQWEIVPGTRVPLPYRSSVICAGHAEGQRSAGATKRGRVVVPEREKENFPQT
LEKCSLSLENMETTSETEDKSGMKRKQTNITDFYQAKRRVVWLPRKSGE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtgcagagggatggctacacttcacaagcgagccctcagtactctaagaaggaacggt
ccccctcggcggagcctgtttggcccagtggaccgagaacagctccagatggagtaccgg
actgccctgcgtaaagatctggaggaggcttcccaacgctgggggttcgacttcttctcc
gacaaacctctggagagcggtgatttccagtgggagattgtcccaggtaccagggtgcca
ctgccctacagatccagcgtcatctgtgcaggacatgcagagggtcaaaggtcagcaggt
gcaaccaaaagaggaagggtggtggtaccagagagggagaaagagaacttcccccaaact
ctagagaaatgttctctgagtctggagaacatggagacaacatcagagacggaagacaaa
tcaggaatgaagaggaaacagacaaacattacagatttctatcaggctaaaagaagagtt
gtctggctgccgaggaaatccggggagtga

DBGET integrated database retrieval system