KEGG   Nothobranchius furzeri (turquoise killifish): 107389601
Entry
107389601         CDS       T05163                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04060  Cytokine-cytokine receptor interaction
nfu04068  FoxO signaling pathway
nfu04144  Endocytosis
nfu04218  Cellular senescence
nfu04350  TGF-beta signaling pathway
nfu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107389601
   04350 TGF-beta signaling pathway
    107389601
   04068 FoxO signaling pathway
    107389601
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107389601
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107389601
  09143 Cell growth and death
   04218 Cellular senescence
    107389601
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107389601
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107389601
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107389601
Protein kinases [BR:nfu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107389601
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 107389601
NCBI-ProteinID: XP_015821307
UniProt: A0A1A8AJX4
LinkDB
Position
sgr14
AA seq 560 aa
MMTRSWTLWSGVSVLLTACLPGAVLSFSYQRDNLCKWCEVSSPVCKDNICFSNCNLTSFC
TVAEEICVSIWRKTNSTMTVQTMCHLPMMPLEGVDPALLLNFTSRECHMVPQPAEDETMM
VCGCQGEHECNDKLIFDKGANGLARLQSKDVIPVVVISLVPLVLVAIVATIAFYFYRVRC
PGKPGPPTRPDWPTKHSPELYQALDMPCEGPGPRGESGGGGLMCPGDELENQVAELLPIK
LDLLVGKGRFAEVWRARLLHSEKGGADSYETVAVKVFPAMEYTSWRNECSIFSENTLQHD
NVVQFLAAEERSPPGNTLQTYWLVLSYHSLGNLQDYLTASTLSWRELIFMAGSIANGLAH
LHSDTTPNGEPKVPVAHRDLKSSNILVKNRNECALCDFGLALRLDLSLTVDDYAHSGQVG
TARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMASRCDAIGEVKSYEPVFGSKVCE
QPCVDSMRDLVLRDRGRPDIPSTWTQHQGMDAFCSTITECWDHDPEARLTAHCVVERFNA
LQHDEEVEEKAEEECARREE
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgatgactcggagctggacgctttggagcggggtctccgtcctcctgacagcatgtctt
ccaggtgctgtcctgtctttcagctaccagagagacaacctgtgtaagtggtgtgaagtt
tccagtccagtgtgtaaggacaacatttgcttcagtaactgcaacttgacctccttctgc
acggtcgccgaggagatctgcgtctccatatggaggaagaccaacagcacaatgacagta
caaacaatgtgtcacctcccgatgatgccactagagggagttgaccccgccttactgctg
aacttcacctctagggaatgtcacatggtcccacagccagcagaggatgaaaccatgatg
gtctgtggctgccagggtgaacacgaatgcaacgacaaactcatctttgacaaaggagca
aatggtctcgctaggttacagagtaaagatgtaatcccagtggtcgtgattagtttggtg
cctcttgttctggtggccatcgttgccaccatcgccttctacttctacagagtacgctgc
cctggtaaaccaggccctcctacacgtcctgactggcccactaaacactctccagagctc
taccaggctttggacatgccatgtgaggggccaggtcccaggggtgaaagtggaggagga
ggtctgatgtgtcctggagatgaactggagaaccaggtggcagaattgctgcccatcaag
ctggatctgctagtgggaaaggggcgctttgctgaagtttggagggcacgcctgctgcac
agtgagaagggtggagctgacagttatgaaactgtggcagtgaaggttttcccagccatg
gagtacacctcttggaggaacgaatgctccatcttctctgaaaatacattacaacatgac
aatgtggttcagttcctggcagctgaagagaggagcccaccaggcaatactctccagaca
tattggctggttttgtcctatcacagcctcggaaacctgcaggactacctcacagccagc
actctgagctggagggagttaatctttatggcaggaagcattgcaaatggattagcgcac
ctccacagtgacacaacgcccaatggagagccaaaggtcccagttgcccatcgagaccta
aagagcagtaacattttggtaaagaacaggaacgagtgtgccctgtgtgacttcggtctg
gcgctgaggttggacctttcactgacagtagatgactacgcccacagtggacaggtgggg
acagctcgatacatggctcctgaggttctggagtccagggtgaacctggaggacctggag
gcctttaaacagatggacgtttactccatggctctggtcctgtgggagatggcctcccgc
tgtgacgctattggagaggtgaagagctatgagccggtgtttggctcaaaggtctgcgag
cagccctgtgtggacagcatgagagacctggttctgagggacagaggacggccggacatc
ccctccacatggacccagcaccaggggatggacgcattctgttccaccatcacagagtgc
tgggatcatgaccccgaggccaggctgacagctcactgcgtcgtggagcgcttcaacgcc
cttcagcacgacgaggaggtagaagagaaagctgaggaagaatgtgcaagaagggaggaa
tga

DBGET integrated database retrieval system