KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103734478Help
Entry
103734478         CDS       T03372                                 

Gene name
Ptgs1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00590  Arachidonic acid metabolism
ngi01100  Metabolic pathways
ngi04611  Platelet activation
ngi04726  Serotonergic synapse
ngi04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103734478 (Ptgs1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103734478 (Ptgs1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103734478 (Ptgs1)
  09156 Nervous system
   04726 Serotonergic synapse
    103734478 (Ptgs1)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103734478 (Ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 103734478
NCBI-ProteinID: XP_008831657
LinkDB All DBs
Position
Un
AA seq 601 aa AA seqDB search
MNRRSLSLRFPLLLLLLLSPLPALPADPGVPAPVNPCCYYPCQNQGICVRFGLDRYQCDC
TRTGYSGPNCTIPDLWTWLRNSLRPSPSFVHFLLTHGSWFWEFVNATFIRETLMRLVLTV
RSNLIPSPPTYNLAHDYVSWESFSNVSYYTRVLPSVPKDCPTPMGTKGKKQLPDVQLLAQ
RLLLRRKFIPAPQGTNLLFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLE
RQYHLRLFKDGKLKYQVLDGEVYPPSVLQAPVLMRYPPGVPREKQMAMGQEVFGLLPGLV
LMSTVWVREHNRVCDLLKAEHPTWDDEQLFQTTRLILIGETIKIIIEEYVQHLSGYFLQL
KFDPELLFRVQFQYRNRIAIEFNHLYHWHPLMPDSFKVGSREYSYEQFLFNTSMLVDYGV
EALVDAFSRQRAGRIGGGRNFDHHVLHVAIEIIKEAREMRLQPFNEYRKRFGMKPYTSFQ
ELTGEKEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEIGAPFSLKGLLGNPI
CSPEYWKPSTFGGEMGFNLVNTASLKKLICLNTKTCPYVSFQVPDLSADNGPDVERPSTE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaggagtctctcgctccggttcccgctgctcctgctgctgctgctgtctccg
ctccccgccctacccgcggaccctggggtgcccgcaccggtcaatccctgttgttactat
ccgtgtcagaaccagggcatctgtgtccgctttggccttgaccgctaccagtgtgattgt
acccgcacgggctactccggccccaactgtaccatccctgatctctggacctggctccgg
aattccctgcggcccagcccctcctttgtccacttcctgctaacacacgggagctggttc
tgggagtttgtgaatgccaccttcatcagagaaacactcatgcgcctggtactcacagtg
cgatccaaccttatccccagccccccgacctacaacttagcacacgactacgtcagttgg
gagtccttctccaatgtgagctattatactcgtgttctgccctcggttcccaaagactgt
cccacgcccatggggaccaaagggaagaagcagctgccagatgtccagctcctggcccaa
cgattactgcttaggaggaagttcatccctgccccccaggggaccaacctcttgtttgcc
ttctttgcacaacacttcacacaccagttctttaaaacttctggaaagatgggtcctggc
tttaccaaggccttgggccatggggtagatcttggtcacatttatggcgataatctggaa
cgtcaataccacctaaggctctttaaggatgggaaactcaagtaccaggtgctggacgga
gaggtgtacccaccgtcagtgctgcaggcgccggtgttgatgcgctacccaccgggtgtc
cctcgtgagaagcagatggccatgggccaggaagtgttcgggctgcttccggggctggtc
ctcatgtccactgtatgggtccgagagcacaaccgggtgtgtgacctgctgaaggcagag
caccccacctgggacgatgaacagctcttccagaccactcgcctcattctcataggggag
accatcaagatcatcattgaggagtatgtgcagcatttgagtggctacttcttgcagctc
aagtttgacccagagctgctgttcagagtccagttccagtaccgcaatcgcattgccatt
gagttcaaccatctttaccactggcacccgctcatgcctgactccttcaaagtgggctca
cgagagtacagctatgagcagttcttgttcaacacctccatgttggtggactatggtgtt
gaggccctggtggatgctttctctcgccagagggctggccggattggtggtggcaggaac
tttgatcaccatgtgctgcacgtggccatagagatcatcaaagaggcccgagagatgcgg
ttacagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccag
gagctcacaggagagaaggagatggctgctgagttggaggagctgtatggagacatcgac
gcattggagttctatcctgggttgcttcttgaaaagtgccagcctaactccatctttggg
gagagtatgatagagattggggctcccttttccctcaagggtctcctagggaatcccatc
tgctctccagagtactggaagcccagcactttcggtggtgagatgggattcaatcttgtc
aacacagcctcgctgaagaaactgatctgtctcaacaccaagacctgcccctatgtttcc
ttccaagtgccagacttgagtgcagacaatgggcctgatgtagagcgaccatccacagag
ctctga

DBGET integrated database retrieval system