KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744793
Entry
103744793         CDS       T03372                                 

Gene name
Nlrp4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103744793 (Nlrp4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ngi04054]
    103744793 (Nlrp4)
Membrane trafficking [BR:ngi04131]
 Autophagy
  Other autophagy associated proteins
   Others
    103744793 (Nlrp4)
Pattern recognition receptors [BR:ngi04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   103744793 (Nlrp4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH AAA_16 LRR_6 AAA_25 LRR_4 Lentivirus_VIF DUF3855 AAA_22
Other DBs
NCBI-GeneID: 103744793
NCBI-ProteinID: XP_008844854
LinkDB
Position
Un
AA seq 983 aa
MASSFFSDFGLMWYLEELNKKEFMKFKELLKQEILHLGLKHIPRMEVKKASREDLANLLM
KYYEEKQAWNVTFEIFQKINRLDLCERAAREIAGHPKIYQAHIKTKFIGIWSRKFTPMVH
DFFDQEITQEEHDYFEYFFPSKTTGNRSHILLLKGVPGIGKTMMLTKLMLAWAEGKIYQN
KFTYVFYFCCQEVKPLTTSLSELISREWPNPSAPIAEIMSQPEKLLFIIDSFEWLRCDLT
EPESELCTDWIEERPMKTLLSSLFRRKILPESSLLIAGTPESLQTLENKFENPEIRTIIG
FDESNRKLFFRCLFPDKYRAQEAYGFVRENEQLFTICQIPLLCWVVAMCLKQEMEKGNDL
TPICRSTTSLYVAYILNLFLPRGTCYPSKKSQEQLQGLCSLAAEGLWTDTFVFSEEALRR
NGLVDSDVPVLLNIKILVKSRESENSYTFLHPSVQEFCAAVFYLLKRHVDHPSTDVKCID
ILLIMFLKKAQARWIFVGCFIFGLLHEIEQEKLRVFFGCQISKERKQQLHQCLETLSKSE
ELWEQVDCLKLFYCLFELRNEAFVIQAMDLIQEVKFEIKDNSDLIVSAYCLKHCTALKKL
SISVRDILRGDQAPKSMANRLICWHQICSVLTTNENLQVLQVKNSGLNESAFMILYNQLR
HPNCPLQVLEINNVSFFCDNHLFFEVFLQNPNLKHLNLSLTVLSHSDVKLLCDVLNHPES
NIEKLLLTDCNLSSSDFEIFAPVLISNKTLKHLNIGSNHLDKGIQSLCQSLCSQNCILKF
LVLANCHLSDNSWGYIREVLLTNKTLSHLDLSSNSLKDEGLKILCEALSLPESGLKSLCL
RNCLITASGCQDLAAVLRSNGNLRSLQISENKVKDAGVKLLCDAVKHPNCHLENLGLEAC
ELTGACCEDLASAFTQSETLWGLNLLENTLDSSGVIVLCEALKQPKCNLHVLGLRVTDFD
EETQAFLIAEEERNPYLTIISNV
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggcatcgtctttcttttccgactttggtcttatgtggtatctggaggagctgaacaag
aaggagttcatgaaatttaaggagcttctcaagcaagagattttgcaccttggactcaag
cacattcctcggatggaggtgaagaaggcttcccgggaagaccttgccaacttactgatg
aagtattatgaagaaaagcaagcctggaatgtgacctttgaaatcttccagaagataaat
aggctggatctctgcgaaagggctgccagagagattgctggacacccaaagatctatcaa
gctcacataaagactaagttcatcggcatttggtccagaaaattcacccctatggttcac
gatttctttgaccaggaaatcacccaggaagaacatgattattttgagtacttttttcca
tcaaagacaactgggaaccgctcccacatactgctcctgaaaggggtcccaggcataggg
aagacaatgatgctgacgaagttaatgctggcctgggcggaaggcaaaatctatcagaat
aaattcacatacgtcttctacttctgctgccaagaagtgaagccactgacaacaagtctg
tctgaactaatctcaagagagtggcctaacccctcagctcccatagcagagatcatgtcc
caacctgagaaactcctgttcatcatcgacagctttgaatggctgagatgcgatttgact
gagccagagtcagagctgtgcactgattggatagaggagcggccaatgaagacactgctg
agcagtttgttcagaaggaagatactcccagagtcctctctgctcatcgccggtacccca
gagagccttcagacactggagaataagttcgagaacccagaaatcagaaccatcataggg
tttgatgagagcaataggaagctgtttttccgctgtttgtttccagataaatacagagct
caggaagcttacggttttgtgagagagaacgagcagctgttcactatctgccagatcccc
ctgctctgctgggtggtagccatgtgtctgaagcaagagatggaaaaggggaatgacctg
acccccatctgccgaagcaccacctccctgtatgtcgcttacatcttgaacttgttcctt
cccagaggcacttgttacccaagtaagaagagccaagagcaactgcagggcctgtgctcc
ctggctgccgagggcctgtggactgacacatttgtgtttagcgaggaggctctcaggaga
aacggattggttgactctgatgtccccgtattgctgaacatcaagattcttgtaaagagc
agggaatcggagaactcctacacatttcttcacccgtctgtccaggagttctgtgctgct
gtgttttatctcctgaagaggcacgtggaccaccctagcactgatgttaaatgcatagac
atactcctgattatgtttctaaagaaagcacaagcacggtggatttttgtggggtgtttc
atatttggccttttacatgaaatagaacaagaaaagctacgggtgttttttggctgccag
atatccaaggagagaaagcagcagcttcaccagtgcctggagaccttaagtaagagcgaa
gagctttgggagcaggtagactgcctgaagttgttttactgtctgtttgagctgcgcaat
gaagcctttgtcattcaagcgatggacttgattcaagaagtgaagtttgagatcaaggat
aactcagatttgatagtttctgcctactgcttaaaacactgcactgcactgaagaaactt
tcgatttcagtacgtgatatcctccggggagatcaagcacccaaatcgatggcaaataga
ctcatctgttggcatcagatatgttctgtactcacaaccaatgagaacctccaggtgctg
caggtgaagaacagtggcctcaatgagtcggcctttatgatcctgtataaccagctgagg
catcccaactgtccccttcaagtccttgagataaacaatgtttccttcttctgtgataac
cacctgttctttgaggtgttcctccagaaccctaatttgaagcatttgaacctcagcctc
acagtcctttcacacagtgatgtgaaactgctctgtgatgtcttgaaccatccagagagc
aacatagaaaagttactgctgaccgactgtaacctctcctccagtgactttgagatcttt
gccccagtcctgatcagcaacaagacgctgaagcatcttaatattggatccaaccacttg
gacaaagggatacagtcactgtgccagtctttatgcagccaaaactgtatcctcaagttc
ctggtgttggccaactgtcacctcagtgacaacagttggggatacatccgtgaagttctt
ctgacaaacaaaaccctgagccacctagacctcagttctaattccctcaaggatgaagga
ctgaagattctctgtgaagccctgagtctccccgaaagtggcctgaaatcactgtgtttg
agaaactgtctcatcactgctagtggctgccaagacctggctgcagtcctccgcagcaat
ggcaacctgagaagtctgcagatctcagaaaataaggtaaaggatgctggtgtaaagctg
ctgtgtgacgctgtgaagcatcccaactgccacctagagaacctaggtctggaggcctgt
gagctaactggtgcctgctgtgaggacctagcttctgcttttacccagagtgagaccctg
tggggacttaacctgttggagaacaccttggacagcagtggggtgattgtgctgtgtgag
gccctgaaacagccaaagtgtaacctgcatgtacttggcctgagagtaactgactttgat
gaggaaacccaagcatttctgatcgctgaggaagagagaaatccctacttaacaatcata
agcaatgtgtaa

DBGET integrated database retrieval system