KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103745303
Entry
103745303         CDS       T03372                                 

Gene name
Nos3
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00220  Arginine biosynthesis
ngi00330  Arginine and proline metabolism
ngi01100  Metabolic pathways
ngi04020  Calcium signaling pathway
ngi04022  cGMP-PKG signaling pathway
ngi04066  HIF-1 signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04151  PI3K-Akt signaling pathway
ngi04370  VEGF signaling pathway
ngi04371  Apelin signaling pathway
ngi04611  Platelet activation
ngi04915  Estrogen signaling pathway
ngi04921  Oxytocin signaling pathway
ngi04926  Relaxin signaling pathway
ngi04931  Insulin resistance
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103745303 (Nos3)
   00330 Arginine and proline metabolism
    103745303 (Nos3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103745303 (Nos3)
   04371 Apelin signaling pathway
    103745303 (Nos3)
   04066 HIF-1 signaling pathway
    103745303 (Nos3)
   04020 Calcium signaling pathway
    103745303 (Nos3)
   04071 Sphingolipid signaling pathway
    103745303 (Nos3)
   04022 cGMP-PKG signaling pathway
    103745303 (Nos3)
   04151 PI3K-Akt signaling pathway
    103745303 (Nos3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103745303 (Nos3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103745303 (Nos3)
   04921 Oxytocin signaling pathway
    103745303 (Nos3)
   04926 Relaxin signaling pathway
    103745303 (Nos3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103745303 (Nos3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103745303 (Nos3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103745303 (Nos3)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103745303 (Nos3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 103745303
NCBI-ProteinID: XP_008845434
LinkDB
Position
Un
AA seq 1202 aa
MGNLKSVGQEPGPPCGLGLGLSLGLCGKQGPASPAPEPSQAPASPSPTPPAPDHSSPLTR
PPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPSQGPLPTE
QLLGQARDFINQYYSSIKRGGSQAHDQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDF
RIWNSQLIRYAGYRQQDGSVRGDPANVEITELCVQHGWTPGNGRFDVLPLLLQAPDESPE
LFTLPPELVLEVSLEHPTLEWFTALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSE
IGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISSSLTPVFHQEMVNYVLSPAFRYQPDPWK
GSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAEGLQLLPGLTHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGGQGGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPPTEPVVVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTFFLDITSPPSPRLLQLLSTLAEESSEQQELEALSQDPRRYE
EWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHITVAVLA
YRTQDGLGPLHYGVCSTWLSQLKAGDLVPCFIRGAPSFRLPPDPNLPCILVGPGTGIAPF
RGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVLDAQQRGVFGHVHTAFSRDP
GSPKTYVQDILRTELATEVHRVLCLEQGHMFVCGDVTMATSVLQTVQRILATEGDMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPNPDNP
GS
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcctgggccaccctgtggcctcgggctcggg
ctgagcctcggactatgtggcaagcaaggtccagcctctccagcaccagagcctagccag
gcaccagcatccccatccccgaccccgccagcaccagaccacagctccccactaactcgg
cccccagagggacccaagttccctcgagtgaagaactgggaagtgggcagcattacctac
gacaccctcagtgcccaggctcagcaggatggaccttgtaccccaagacgctgcctagga
tccctggtatttccaaggaagctacagagccggccctcccagggtcctctacccactgag
cagctgttaggtcaggccagggacttcatcaaccagtactacagctccatcaagaggggt
ggctcccaggcccatgaccagcggcttcaggaagtagaggctgaggtggcagccactggc
acctaccagctccgggaaagtgagttggtattcggagctaagcaggcctggcgcaatgct
ccccgctgtgtgggccggatccagtggggaaagctgcaggtgtttgatgcccgggactgc
agaactgcacaggaaatgttcacctacatctgcaaccacatcaagtatgccaccaaccga
ggcaaccttcgttcggccatcacagtgttcccccagcgctgccccggccggggagacttc
cggatctggaacagccagctgatacgctacgcaggctataggcaacaggatggctccgtg
cgaggggaccctgccaacgtggagatcactgagctctgtgtccagcatggttggacccca
ggaaatggtcgctttgacgtgctgcctctgctgctccaggcccctgatgagtccccagaa
ctcttcactctgcccccagagctggtcctcgaggtgtccctggagcaccccacgctggag
tggttcactgccctgggcctgcgctggtacgccctcccagctgtgtccaacatgctgcta
gaaatcgggggccttgagttccctgccgcccccttcagtggctggtacatgagctcagag
attggcatgagggacttgtgtgaccctcaccgttacaacattcttgaggacgtggccgtc
tgtatggatttagacacccggacaacctcatccctgtggaaagacaaggcggccgtggag
attaatgtggccgtgctgcacagttaccagctcgccaaagtgaccattgtggaccaccat
gccgccactgcctccttcatgaagcacctggagaacgaacaaaaggccagggggggctgc
cctgctgactgggcctggatcgtgccccccatctccagcagcctcactcctgtcttccat
caagagatggtcaactatgtcttgtcacctgccttccgctaccagccagacccctggaag
ggaagtgcagcgaagggcacaggcatcaccaggaagaagacctttaaggaagtggccaat
gcagtgaagatctctgcctcactcatgggcacagtgatggcaaagcgcgtgaaggcaacc
atcctgtatggctctgagactggcagagcccagagctatgcacagcagctggggaggctc
ttccggaaggcgtttgacccccgggtcctgtgcatggatgagtacgatgtggtgtcccta
gaacatgaagcactggtgttggtggtgaccagcacattcgggaacggagatcccccagag
aatggagagagctttgcagcagcgttgatggagatgtcaggcccctacaacagctcccca
aggcctgagcaacataagagttacaaaatccgattcaacagtgtctcatgctcagacccc
ctggtgtcctcttggcgacgcaagaggaaggaatctagcaacacagacagtgcaggggcc
ctgggcaccctcaggttctgtgtgtttggactgggatctcgggcctacccccacttctgt
gcctttgcacgggctgtggatacacggctagaagagctgggtggggagcggctactacag
ctgggccagggtgacgagctctgtggccaggaggaggcctttcgtggctgggcacaggct
gccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaggccgctgctcgg
gacatcttcagccccaaacgcagctggaagcgccagaggtatcgactgagtacccaggct
gagggcctgcagctgctgccaggcctgacccacgtgcacaggcggaagatgttccaggct
acgatcctctctgtggaaaacctgcagagcagcaaatctacccgggccacgatcctggtg
cgcctggacaccggaggccagggagggctgcagtaccagccaggggaccacataggtgtg
tgcccacccaaccggcctggactcgtggaggcattgctgagccgtgtggaggacccaccc
ccacccacagagcccgtggtcgtggagcagctggagaagggaagccctggtggccctccc
cccggctgggtacgggacccccggctgcccccatgcacgctgcgacaggctctcaccttc
ttcctggacatcacttccccgcccagtcctcgtctccttcaactgctcagcaccctggcc
gaagagtccagcgaacagcaggaacttgaggccctcagccaggacccccgacgctatgaa
gagtggaagtggttccgctgccccacgctgttggaggtgctggagcagttcccatcagtg
gccctgcctgccccactgctcctcacccagctgcccctgctccagccccggtactactca
gtcagctcagcacccagcacccacccaggagagatccacatcactgtggctgtgctggca
tacaggacccaggatgggctgggccctcttcactatggtgtctgctccacgtggctgagc
caactcaaggctggagacctggtaccctgcttcatcaggggggctccctccttccgactg
ccacctgatcccaacttgccctgcattctggtgggcccagggactggcattgcacccttc
cggggattctggcaagagcgactgcacgatattgagagtaaagggctgcagccggctccc
atgactttggtgttcggctgccgatgctcccaactggatcatctctaccgagatgaggtg
ctggacgcccagcagcgcggggtgtttggacatgtccacaccgccttctccagggatcct
ggcagccccaagacctacgtgcaggacatcctgaggactgagctggctacggaagtgcac
cgcgtgctgtgcctcgagcaaggccacatgtttgtgtgcggggatgtcaccatggcaacc
agcgtgctgcagacagtgcagcgaattctggcgacagagggcgacatggagctggacgag
gcgggtgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaggacatttttggg
ctcacattgcgcacccaggaggtgacaagccgtatacgcacccagagtttttctttgcag
gagcgacagttgcggggtgcagtgccctgggccttcgacccgcccaacccagacaaccct
ggttcatga

DBGET integrated database retrieval system