KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_PA03880Help
Entry
RG1141_PA03880    CDS       T03208                                 

Definition
(GenBank) Two component transcriptional regulator, winged helix family
  KO
K02483  two-component system, OmpR family, response regulator
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Brite
KEGG Orthology (KO) [BR:ngl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ngl02022]
    RG1141_PA03880
Two-component system [BR:ngl02022]
 OmpR family
  Unclassified
   RG1141_PA03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CDN57223
UniProt: A0A068TFP1
LinkDB All DBs
Position
pHAMBI1141a:396238..396978
Genome map
AA seq 246 aa AA seqDB search
MDHIDHILIVDDDREIRELVSSYLKKNGLRATVAADGRQMRSFLEANSVDLIVLDVMMPG
DDGLVLCRELRAGKHKTTPILMLTARSDEMDRIIGLEMGADDYLPKPFAARELLARIKAV
LRRTRMLPPNLQISEAGQLLSFGDWRLDTIGRHLLDKQGTEIALSGAEYRLLRVFIDHPQ
RVLNRDQILNLTQGRDADLFDRSIDLLVSRLRQRLGDDAREPTYIKTVRSEGYVFSVPVA
ISEPKP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggatcatatcgaccatatcctgatcgtcgatgacgaccgcgaaatccgcgaactggta
tcgagctatctgaagaagaacgggcttcgcgcgacggtggccgcggatggccgccagatg
cgcagttttctcgaggccaattcggtcgatctgatcgtgctcgacgtgatgatgccgggt
gatgatggtctggtgctctgccgcgaactcagggccggcaagcacaagacgacgccgatc
ctgatgttgaccgcccgcagcgacgagatggaccggatcatcgggctcgaaatgggtgcc
gacgattatctgccgaaaccgtttgccgcgcgcgaattgctggcgcgcatcaaggccgtc
ctgcgccggacgcgcatgctgccgcccaacctgcagatcagcgaagcaggccagttgctg
agcttcggtgactggcggctcgatacgatcggccgccatctgctcgacaaacagggcacg
gaaatcgcgctgagcggcgccgaataccggctgctgcgggtcttcatcgaccatccgcag
cgcgtgctcaaccgcgaccagatcctcaacctcacgcaaggccgtgatgccgatcttttc
gaccggtcgatcgaccttctggtgagccggcttcgccagcggctcggcgacgatgcgcgc
gagccgacctatatcaagaccgtgcgcagcgaaggttacgtcttctcggtccccgttgcg
atctcggagccgaagccgtga

DBGET integrated database retrieval system