KEGG   Naegleria gruberi: NAEGRDRAFT_76995Help
Entry
NAEGRDRAFT_76995  CDS       T01241                                 

Definition
(RefSeq) hypothetical protein
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
ngr  Naegleria gruberi
Brite
KEGG Orthology (KO) [BR:ngr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NAEGRDRAFT_76995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ngr01003]
    NAEGRDRAFT_76995
Enzymes [BR:ngr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     NAEGRDRAFT_76995
Glycosyltransferases [BR:ngr01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   NAEGRDRAFT_76995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563
Motif
Other DBs
NCBI-GeneID: 8858673
NCBI-ProteinID: XP_002668094
JGI: Naegr1_76995
LinkDB All DBs
AA seq 576 aa AA seqDB search
MSILFLGILKRVLRVDMNGLSFINVRSEILSSSRSIDNVDNEEIVVINDSLSHLSPIVQT
PKTSLKSTETSSKIKEIGNTNETSIKSVSSPVNNTFNININKHVSIPPLTCYESVGQGRQ
LGNQFQTQIELCETDFGCGMLERWKQQKLIMCERHQHSLLRSYNDNSYPSQLTCYKHNNL
HLPPATFPHTVCDGENIVFDFSKMLHASCLKYRPGYFCKKPTYYHYEYGALNGNCKRTDR
FFSVDDFSKDFGKDVFSSFSTFESPFEKPIQFIDGITIFVSREQDEHVNMFHSMTDFFAT
YLMIEMFQLNSSQVQIVLLDDHYDGPFDFLWNSVFSLKRPMMKASQFNNSTVRFERAIFQ
HAGYATHFLSHVLDFDKQDPRMCHSKIPLVSSFANRIIQLLGIKKREMKKGDMVKGLFIS
RKPYVKNGINHQFMGRQISNEDELMAFFRMHPLHSTNFTIEKIDFASLSLVEQIQKVHNS
DFLIGYHGAGLTHSLWLPEDSSGVLEIWKSAFSKSWRCFEQLTLWKGNYYDLWSNTNGWN
LRTDADGDYLRVEPYSINGQFSKMINQLTISRSFES
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctatttcttggaatactgaagagagtattaagagtagacatgaatggttta
tcgtttattaatgtgaggagtgaaatcctgtcatcttctaggagcattgataatgtcgac
aatgaggaaattgtagttattaatgatagtctatcccatctttcacccattgttcaaact
ccaaagacatctctcaaatcaaccgaaactagtagtaaaatcaaagaaattggaaataca
aatgagacttccatcaaatcagtatcaagccctgtaaacaacactttcaacatcaacatc
aacaaacatgtgtctattccaccacttacatgctacgagagtgtaggtcagggtagacaa
cttggaaatcaattccaaacacaaattgaattgtgtgaaactgactttggatgtggaatg
cttgaaagatggaaacaacaaaagttgatcatgtgtgaaaggcatcaacattcattattg
agaagttataatgataactcatatccttcacaattaacatgttacaaacacaacaacctt
catctacctccagcaacatttccacatactgtatgtgatggagagaatattgtatttgac
ttttccaagatgttacatgcatcatgtctaaaatatagacctggttatttctgtaagaaa
ccaacttattatcattatgaatatggtgcgttgaatggaaattgcaagagaactgataga
ttctttagtgttgatgatttttccaaagattttggaaaggatgtcttttcaagtttttcc
acatttgaatctccctttgagaaaccaatccaattcattgatggcataacaatctttgtt
tcgagagaacaagatgagcatgtgaacatgtttcattcaatgactgatttctttgccact
tatctcatgattgaaatgtttcaactcaacagttctcaagttcaaattgttttattggat
gatcattatgatggtccatttgattttctgtggaattctgtcttttcactcaaaagacca
atgatgaaagcttcacaattcaataattcaactgtgagatttgagagagcaatctttcaa
catgctggttatgcaacacatttcctttctcatgtgttggattttgataaacaagatcca
agaatgtgtcattccaaaatacctctcgtctcatcctttgctaatagaatcattcaatta
ttgggtattaagaagagagaaatgaagaagggagatatggtgaaaggtttattcatcagc
agaaaaccatacgttaagaatggtattaatcatcaatttatgggaaggcagattagtaat
gaagatgaattgatggcattctttaggatgcatccacttcatagcaccaattttacaatt
gaaaagattgattttgcatcactttcacttgttgagcaaattcaaaaggttcacaattct
gattttctcataggttatcatggagctggattgactcattcattatggttaccagaagac
tcttcaggagtattggaaatttggaaatctgcattttcaaagagttggagatgtttcgaa
caattaacattatggaaaggaaattattatgatttgtggtcgaatacaaatggttggaat
ttgagaacagatgcagatggtgattatctcagagttgaaccatatagtattaatggtcaa
ttttctaaaatgattaatcaattgaccataagtagatcttttgaaagttaa

DBGET integrated database retrieval system