Fusarium vanettenii: NECHADRAFT_53227 Help Entry NECHADRAFT_53227  CDS       T01612                                  Name (RefSeq) hypothetical protein   KO K04513   Ras homolog gene family, member A Organism nhe  Fusarium vanettenii Pathway nhe04011   MAPK signaling pathway - yeast nhe04144   Endocytosis Brite KEGG Orthology (KO) [BR:nhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     NECHADRAFT_53227  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     NECHADRAFT_53227  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:nhe04131]     NECHADRAFT_53227   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nhe04147]     NECHADRAFT_53227    04031 GTP-binding proteins [BR:nhe04031]     NECHADRAFT_53227 Membrane trafficking [BR:nhe04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     NECHADRAFT_53227 Exosome [BR:nhe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NECHADRAFT_53227   Exosomal proteins of other body fluids (saliva and urine)    NECHADRAFT_53227   Exosomal proteins of colorectal cancer cells    NECHADRAFT_53227   Exosomal proteins of bladder cancer cells    NECHADRAFT_53227 GTP-binding proteins [BR:nhe04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     NECHADRAFT_53227 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Motif Other DBs NCBI-GeneID:  9679293 NCBI-ProteinID:  XP_003040868 JGI:  53227 UniProt:  C7ZL88 LinkDB All DBs Position 12 AA seq 146 aa AA seqDB search VDITMTDTPGQMDYDRLRPLCYPNGNVIVLTFDKSIPECFDNIEEAWMPEIQHFLPNTPI VLVGNKKDLEYDPKIIQEAKKIGYHPVTYEEAKKAAKLPGVVKFLETSAKTGEGIKEVFE FAALYALLGMGQEKPPSIFRRLFSKK NT seq 441 nt NT seq  +upstreamnt  +downstreamnt gtcgacattaccatgaccgacacgccgggccagatggactatgatcgcttgcgccctctt tgttacccaaatggcaacgtcattgtattgacctttgacaagagcattccagagtgtttc gacaatatcgaagaagcgtggatgcccgagattcaacactttctacctaatacccccatc gtactcgtgggaaataagaaggacctcgagtacgaccctaaaataatccaagaagcgaag aagataggttaccacccagtcacttatgaagaggcaaaaaaggcggccaaacttccaggg gtggtcaaattcctcgagacttctgccaagacgggggaaggtatcaaggaggtgtttgaa ttcgctgctctgtacgccttgctggggatgggccaggagaagcccccaagtatcttcagg agactgttctcaaagaaatga

DBGET integrated database retrieval system