KEGG   Nectria haematococca: NECHADRAFT_84145Help
Entry
NECHADRAFT_84145  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
Organism
nhe  Nectria haematococca
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-GeneID: 9667647
NCBI-ProteinID: XP_003048382
JGI: 84145
UniProt: C7YZU2
LinkDB All DBs
Position
8
AA seq 710 aa AA seqDB search
MSKIAHEQLKNDWIRPSFNHAASTHAILAFTALRLSMARPDVPYYVRFAERQRLLAIMAM
RRSLEYSDEATCNENLTAVYNLICFEETLFLSSLSHSGNKALQPDYTQLKAHIDGLRQMV
SLRGDSQVSFDDRRQRVEPNFAEQLILGPYSGPTSGNIGLQTKMALPRGLMKQIYSYPES
SFFFTELTVKASSWCKAGIHHGLREFLVTVDCLLKDTSAWLRQPDSYKWDLLGVQGLYGL
AIEMFPRWQYEASYGASNADHLVALFTAVLIFFISNNGQLLDNIPMPLSDIQDLVSDPKV
WPTMRAAGLDLWLAFLLVLSSSHQAAYREYFFRIHLDTLETHRPEIRSVEDYVENLHNTL
WLPQRLDNLGVNHSSLPDLGDPSWLCSDLIIRAAFKARQLIHPCPHLYQHQPQSSSINIA
MSATQSKVDILRERLNTAKPAIAMAAHSPLGAKLVEEAGFGAVWVSGFELSASYAVPDAS
ILPMSTILEMTRAMGEVQNLPLIVDLDTGFGNAVNVAYAVPRFAAAGATAVVIEDKAFPK
DSSLRAGGRHALVSIPEFQGKIAAAKVSPVLVIARTEALIAGLGEEKAIKRAMAYAEAGA
DTVLVHSKQKTPDEILSFCKAWTGTVPLVIVPTSYPQLSFAEVAALDKVGLIICGNHAVR
AAVASMRRTFKHILEDGGIGRVEEEITPVSEIFALQGDDHMRSVEKDYLR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaattgcgcatgagcaactcaagaacgactggatcaggccttctttcaatcat
gccgcgtctacgcatgccatcttggcattcacggcgcttcgactatccatggcacgtcca
gatgtaccctactacgtcagatttgctgaacgccaaagacttctcgccataatggcgatg
cggcgaagtctggagtactctgatgaagcaacatgcaatgagaatctcacggccgtatac
aatctcatttgctttgaggaaaccctgttcctttcttctctctcacactctgggaacaaa
gcactgcagccggattatacccaactcaaggctcatattgatggccttaggcaaatggtt
tctctgcggggtgattctcaggtctctttcgacgatcggcgtcagagggtcgagccaaat
ttcgcagagcaactaattcttgggccgtacagtggtcccacgtcagggaacatcggacta
cagacgaaaatggcactacccagagggttgatgaaacagatctacagctacccagagtct
tcattcttttttaccgaattgactgtcaaagcctccagctggtgcaaggccggtattcat
cacgggctccgcgagttcttggtaactgtcgactgcctcttgaaggatacatccgcctgg
cttcgtcagcctgacagttacaagtgggacttgctaggtgtccagggtttatacggttta
gccattgaaatgttcccacgatggcagtacgaagcatcctatggggcatcaaatgcggat
catctagtggcgttgtttacagcagtgctcatcttcttcatcagcaacaacggccagctc
ctggataacattcccatgcctttatcagatatccaagatctggtgtccgatccgaaagtt
tggcccaccatgagggcagccggactggatctatggcttgcgtttctgcttgtgctttct
tcaagtcatcaggctgcctacagggaatatttcttcagaatacacctcgacacactagag
acccatagaccagaaattcgctcggttgaagactacgtcgagaatttgcacaacacattg
tggctcccgcaacgtctggacaatcttggtgtgaatcactcgtctctccccgatctcggc
gatccttcttggctttgctcggacttgataatccgagctgcattcaaggcacgtcagctg
attcatccatgcccgcacctctaccaacaccagccacaatcttcctcgatcaacatcgcc
atgtcagcaacccaatccaaagtcgacattctccgcgagagactaaacacagccaagcca
gcaattgccatggccgctcatagtccgctcggcgccaaattggtagaagaagctggcttc
ggggcagtctgggtcagtggatttgaactgtcagcttcatacgctgtgcccgacgccagc
atcttacccatgagcaccatccttgagatgacgcgcgcaatgggcgaggttcagaacctc
cctctcattgtcgaccttgatacaggctttggcaacgcggtcaacgtggcctacgccgtt
cctcgctttgctgcagcgggcgcaacggccgtcgtcatcgaagacaaggcatttcccaaa
gacagcagcctacgggctggaggccgacacgccctggtttctatcccagagttccagggt
aagatcgctgcggcaaaagtcagcccggtgcttgtcattgcccggacagaggcattgatc
gctggattgggagaggaaaaagccataaagcgtgctatggcctacgctgaagctggggca
gatacggtcctagttcacagcaagcaaaaaacaccagatgagatcctgtcgttttgcaaa
gcttggacggggactgtgcccctggtaatagtgccaactagctacccgcaactatcattc
gccgaggtggcagcacttgacaaggttggactgatcatctgtggtaatcatgctgttaga
gcagccgtggcgtcaatgagacgcacgtttaaacacatccttgaagacggaggtattggt
cgagtggaagaggagataactccggtatctgagatctttgcactccagggagatgaccac
atgcgttcagttgagaaggattaccttcgctag

DBGET integrated database retrieval system