Natronosporangium hydrolyticum: JQS43_06225 Help Entry JQS43_06225       CDS       T07914                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism nhy  Natronosporangium hydrolyticum Pathway nhy00253   Tetracycline biosynthesis nhy01056   Biosynthesis of type II polyketide backbone nhy01100   Metabolic pathways nhy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nhy00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     JQS43_06225    00253 Tetracycline biosynthesis     JQS43_06225  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:nhy01004]     JQS43_06225    01008 Polyketide biosynthesis proteins [BR:nhy01008]     JQS43_06225 Lipid biosynthesis proteins [BR:nhy01004]  Polyketide synthase   Component type    JQS43_06225 Polyketide biosynthesis proteins [BR:nhy01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      JQS43_06225     Nonaketide PKS      JQS43_06225     Decaketide PKS      JQS43_06225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSB15925 UniProt:  A0A895YIV7 LinkDB All DBs Position complement(1359098..1359358) Genome browser AA seq 86 aa AA seqDB search MSREISLSDLRLILREAAGADEGVDLDADILDTAFADLGYDSLALLEASSRIERQFSVSL EESMLAEAATPREFLDVVNAHLDSAR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcccgagaaatctccctatccgatctgcggctgatcctccgcgaggctgccggtgcc gacgaaggcgtcgacctcgacgccgacatcctggacaccgccttcgccgacctgggttac gactcgcttgccttgctagaggccagcagtcggatcgagcgccagttctcggtctcgctg gaagagtccatgttggccgaggcggcgacgccccgggaattcctggacgtcgtcaacgct cacctcgactccgcacgctaa

DBGET integrated database retrieval system