KEGG   Nitrospira japonica: NSJP_2641Help
Entry
NSJP_2641         CDS       T05001                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nja  Nitrospira japonica
Brite
KEGG Orthology (KO) [BR:nja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nja01001]
    NSJP_2641
Enzymes [BR:nja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NSJP_2641
Protein kinases [BR:nja01001]
 Serine/threonine kinases: Other
  Bacterial family
   NSJP_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal APH_6_hur Kdo
Motif
Other DBs
NCBI-ProteinID: SLM48808
UniProt: A0A1W1I6Z9
LinkDB All DBs
Position
I:complement(2518479..2519879)
Genome map
AA seq 466 aa AA seqDB search
MSKAWNWIVPHMFGILAALLAGPILGRLASVHAFSIPALSLSGNAAVRLGADVVALALLL
SLALNAYREIPDNGRGSSFLRHIVIPLAVLTAIVYGDKAFRGVGLPLVERFGSVRYLWAY
TSGIIASGLWLTVAWLSHLGSLREAFCPARHVKRPGQHASADDESGETNLDGVQEEEPQD
GSATMLLTGTPPSMLGRYKVLKELGRGAMGIVYLGKDPTIQRFVAIKTMRLDQIDDGTKL
QEVKARFFREAESAGRLSHPNIVTIYDAGEQDELGYIAMEVLEGSSLKQWSRPPNLMSVA
DVVHALTTVAEALDHAHQQGVVHRDVKPANVMLTKDRIVKVMDFGIAKMASSSKTQTDLV
LGTPTYMSPEQIAGKKVDGRSDIFSLGVVLFELLTGRPPFIADNLSALLFAIAHQPHPPL
NALRKDLPPMFQEVLDRALQKELPQRYRRAGEFARDLRACLQSLAA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggcctggaactggatcgttccgcatatgttcggaattctggcggcgctcctt
gccggaccgattctcggccgtttggcctcggttcatgccttttccatccccgctctctcc
ttgagtggaaacgcggccgttcgccttggcgccgacgtcgtcgcgctggcgctcctcctg
tctctggccttgaacgcctatcgggaaatccccgacaacggccggggctcgagttttctc
cgacatatcgtcattccgcttgcggtgttgaccgccatcgtctatggagacaaggcattt
cgcggagtcgggttacctctcgtcgaacgcttcggatccgtccgctatctctgggcttat
acctccgggatcatcgcctccggactatggctcaccgtggcatggctgagtcatctcggc
tcactgcgggaggccttctgtcccgcgcggcacgtcaaacgccccggtcagcacgcctcg
gccgacgacgaatcgggcgagacgaacctggacggcgttcaagaggaggagccgcaggac
ggttcggctactatgctactgacgggaacgcctccctccatgctcggtcggtacaaagtc
ctaaaggagctgggacgaggcgccatgggcatcgtctatctcggcaaggatccgacgatc
caacgattcgtggcgatcaagaccatgcgcttggaccagatcgacgacggcacaaaattg
caggaggtcaaggcgcgatttttccgcgaagcggaatcggccggccggctgtcccatccc
aatatcgtcacgatctacgacgcaggcgaacaggatgaactcggatacatcgcaatggaa
gtcttggaaggcagctcgctcaaacaatggtcgcggccgccgaacttgatgtccgtcgcg
gacgtcgtgcatgccttgaccaccgtggcggaggccttggaccatgcgcaccaacaggga
gtagtccatcgggacgtcaagccggccaacgtcatgctgaccaaggaccggatcgtgaag
gtgatggacttcggcatcgccaagatggcctcgagcagcaagacccagaccgacctcgta
ctgggcacgccgacctatatgtcgcccgaacagatcgcgggaaagaaagtggacggccgg
tccgatattttttcgctgggagtggtcttgttcgaactgctgaccggccggcctcccttc
atcgcggacaacctgtcggcgctgctctttgccattgcccaccagccgcacccgcccttg
aatgcactgcgaaaggaccttcccccgatgttccaggaagtactcgacagggcgctgcag
aaggaactccctcagcgatatcgccgcgccggagagtttgcacgcgacctccgggcctgc
ctccagagcctcgcggcttga

DBGET integrated database retrieval system