KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100579779
Entry
100579779         CDS       T03265                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04020  Calcium signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04114  Oocyte meiosis
nle04140  Autophagy - animal
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04310  Wnt signaling pathway
nle04340  Hedgehog signaling pathway
nle04371  Apelin signaling pathway
nle04530  Tight junction
nle04540  Gap junction
nle04611  Platelet activation
nle04713  Circadian entrainment
nle04714  Thermogenesis
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04727  GABAergic synapse
nle04728  Dopaminergic synapse
nle04740  Olfactory transduction
nle04742  Taste transduction
nle04750  Inflammatory mediator regulation of TRP channels
nle04910  Insulin signaling pathway
nle04911  Insulin secretion
nle04912  GnRH signaling pathway
nle04913  Ovarian steroidogenesis
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04918  Thyroid hormone synthesis
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04922  Glucagon signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04924  Renin secretion
nle04925  Aldosterone synthesis and secretion
nle04926  Relaxin signaling pathway
nle04927  Cortisol synthesis and secretion
nle04928  Parathyroid hormone synthesis, secretion and action
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle04961  Endocrine and other factor-regulated calcium reabsorption
nle04962  Vasopressin-regulated water reabsorption
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04976  Bile secretion
nle05012  Parkinson disease
nle05020  Prion disease
nle05030  Cocaine addiction
nle05031  Amphetamine addiction
nle05032  Morphine addiction
nle05034  Alcoholism
nle05146  Amoebiasis
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100579779 (PRKACA)
   04014 Ras signaling pathway
    100579779 (PRKACA)
   04310 Wnt signaling pathway
    100579779 (PRKACA)
   04340 Hedgehog signaling pathway
    100579779 (PRKACA)
   04371 Apelin signaling pathway
    100579779 (PRKACA)
   04020 Calcium signaling pathway
    100579779 (PRKACA)
   04024 cAMP signaling pathway
    100579779 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100579779 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100579779 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100579779 (PRKACA)
   04540 Gap junction
    100579779 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100579779 (PRKACA)
   04062 Chemokine signaling pathway
    100579779 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    100579779 (PRKACA)
   04910 Insulin signaling pathway
    100579779 (PRKACA)
   04922 Glucagon signaling pathway
    100579779 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    100579779 (PRKACA)
   04912 GnRH signaling pathway
    100579779 (PRKACA)
   04913 Ovarian steroidogenesis
    100579779 (PRKACA)
   04915 Estrogen signaling pathway
    100579779 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    100579779 (PRKACA)
   04921 Oxytocin signaling pathway
    100579779 (PRKACA)
   04926 Relaxin signaling pathway
    100579779 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    100579779 (PRKACA)
   04918 Thyroid hormone synthesis
    100579779 (PRKACA)
   04919 Thyroid hormone signaling pathway
    100579779 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    100579779 (PRKACA)
   04916 Melanogenesis
    100579779 (PRKACA)
   04924 Renin secretion
    100579779 (PRKACA)
   04925 Aldosterone synthesis and secretion
    100579779 (PRKACA)
   04927 Cortisol synthesis and secretion
    100579779 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100579779 (PRKACA)
   04270 Vascular smooth muscle contraction
    100579779 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    100579779 (PRKACA)
   04971 Gastric acid secretion
    100579779 (PRKACA)
   04976 Bile secretion
    100579779 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100579779 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100579779 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100579779 (PRKACA)
   04727 GABAergic synapse
    100579779 (PRKACA)
   04725 Cholinergic synapse
    100579779 (PRKACA)
   04728 Dopaminergic synapse
    100579779 (PRKACA)
   04726 Serotonergic synapse
    100579779 (PRKACA)
   04720 Long-term potentiation
    100579779 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    100579779 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    100579779 (PRKACA)
   04742 Taste transduction
    100579779 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    100579779 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    100579779 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    100579779 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100579779 (PRKACA)
   04714 Thermogenesis
    100579779 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100579779 (PRKACA)
   05205 Proteoglycans in cancer
    100579779 (PRKACA)
   05203 Viral carcinogenesis
    100579779 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100579779 (PRKACA)
   05020 Prion disease
    100579779 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    100579779 (PRKACA)
   05031 Amphetamine addiction
    100579779 (PRKACA)
   05032 Morphine addiction
    100579779 (PRKACA)
   05034 Alcoholism
    100579779 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100579779 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100579779 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100579779 (PRKACA)
   05163 Human cytomegalovirus infection
    100579779 (PRKACA)
   05165 Human papillomavirus infection
    100579779 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100579779 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100579779 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100579779 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nle03019]
    100579779 (PRKACA)
   03036 Chromosome and associated proteins [BR:nle03036]
    100579779 (PRKACA)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100579779 (PRKACA)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PKA family
   100579779 (PRKACA)
Messenger RNA biogenesis [BR:nle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100579779 (PRKACA)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100579779 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100579779
NCBI-ProteinID: XP_030676478
Ensembl: ENSNLEG00000013417
LinkDB
Position
10
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKDTGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaaacacaaggatactgggaaccactatgctatgaagatcctcgacaaacagaaggtg
gtgaaactgaaacagatcgaacacaccctgaatgaaaagcgcatcctgcaagctgtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcaaacttatacatggtc
atggagtacgtgcccggtggggagatgttctcacacctaaggcggatcggaaggttcagc
gagccccatgcccgtttctacgcggcccagatcgtcctgacctttgagtatctacactcg
ctggatctcatctacagggacctgaagccggagaatctgctcattgaccagcagggctac
attcaggtgacagacttcggttttgccaagcgcgtgaagggccgcacttggaccttgtgc
ggcacccctgagtacctggcccctgagattatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctgggggttcttatctatgaaatggccgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctgggaaggtgcggttcccttcc
cacttcagctctgacttgaaggacctgctgcgaaacctcctgcaggtagatctcaccaag
cgctttgggaacctcaagaatggggtcaacgatatcaagaaccacaagtggtttgccaca
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggatacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100583577
Entry
100583577         CDS       T03265                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X8
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04020  Calcium signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04114  Oocyte meiosis
nle04140  Autophagy - animal
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04310  Wnt signaling pathway
nle04340  Hedgehog signaling pathway
nle04371  Apelin signaling pathway
nle04530  Tight junction
nle04540  Gap junction
nle04611  Platelet activation
nle04713  Circadian entrainment
nle04714  Thermogenesis
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04727  GABAergic synapse
nle04728  Dopaminergic synapse
nle04740  Olfactory transduction
nle04742  Taste transduction
nle04750  Inflammatory mediator regulation of TRP channels
nle04910  Insulin signaling pathway
nle04911  Insulin secretion
nle04912  GnRH signaling pathway
nle04913  Ovarian steroidogenesis
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04918  Thyroid hormone synthesis
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04922  Glucagon signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04924  Renin secretion
nle04925  Aldosterone synthesis and secretion
nle04926  Relaxin signaling pathway
nle04927  Cortisol synthesis and secretion
nle04928  Parathyroid hormone synthesis, secretion and action
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle04961  Endocrine and other factor-regulated calcium reabsorption
nle04962  Vasopressin-regulated water reabsorption
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04976  Bile secretion
nle05012  Parkinson disease
nle05020  Prion disease
nle05030  Cocaine addiction
nle05031  Amphetamine addiction
nle05032  Morphine addiction
nle05034  Alcoholism
nle05146  Amoebiasis
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100583577 (PRKACB)
   04014 Ras signaling pathway
    100583577 (PRKACB)
   04310 Wnt signaling pathway
    100583577 (PRKACB)
   04340 Hedgehog signaling pathway
    100583577 (PRKACB)
   04371 Apelin signaling pathway
    100583577 (PRKACB)
   04020 Calcium signaling pathway
    100583577 (PRKACB)
   04024 cAMP signaling pathway
    100583577 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100583577 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100583577 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100583577 (PRKACB)
   04540 Gap junction
    100583577 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100583577 (PRKACB)
   04062 Chemokine signaling pathway
    100583577 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    100583577 (PRKACB)
   04910 Insulin signaling pathway
    100583577 (PRKACB)
   04922 Glucagon signaling pathway
    100583577 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    100583577 (PRKACB)
   04912 GnRH signaling pathway
    100583577 (PRKACB)
   04913 Ovarian steroidogenesis
    100583577 (PRKACB)
   04915 Estrogen signaling pathway
    100583577 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100583577 (PRKACB)
   04921 Oxytocin signaling pathway
    100583577 (PRKACB)
   04926 Relaxin signaling pathway
    100583577 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    100583577 (PRKACB)
   04918 Thyroid hormone synthesis
    100583577 (PRKACB)
   04919 Thyroid hormone signaling pathway
    100583577 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    100583577 (PRKACB)
   04916 Melanogenesis
    100583577 (PRKACB)
   04924 Renin secretion
    100583577 (PRKACB)
   04925 Aldosterone synthesis and secretion
    100583577 (PRKACB)
   04927 Cortisol synthesis and secretion
    100583577 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100583577 (PRKACB)
   04270 Vascular smooth muscle contraction
    100583577 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    100583577 (PRKACB)
   04971 Gastric acid secretion
    100583577 (PRKACB)
   04976 Bile secretion
    100583577 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100583577 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100583577 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100583577 (PRKACB)
   04727 GABAergic synapse
    100583577 (PRKACB)
   04725 Cholinergic synapse
    100583577 (PRKACB)
   04728 Dopaminergic synapse
    100583577 (PRKACB)
   04726 Serotonergic synapse
    100583577 (PRKACB)
   04720 Long-term potentiation
    100583577 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    100583577 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    100583577 (PRKACB)
   04742 Taste transduction
    100583577 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    100583577 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    100583577 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    100583577 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100583577 (PRKACB)
   04714 Thermogenesis
    100583577 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100583577 (PRKACB)
   05205 Proteoglycans in cancer
    100583577 (PRKACB)
   05203 Viral carcinogenesis
    100583577 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100583577 (PRKACB)
   05020 Prion disease
    100583577 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    100583577 (PRKACB)
   05031 Amphetamine addiction
    100583577 (PRKACB)
   05032 Morphine addiction
    100583577 (PRKACB)
   05034 Alcoholism
    100583577 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100583577 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100583577 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100583577 (PRKACB)
   05163 Human cytomegalovirus infection
    100583577 (PRKACB)
   05165 Human papillomavirus infection
    100583577 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100583577 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100583577 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100583577 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nle03019]
    100583577 (PRKACB)
   03036 Chromosome and associated proteins [BR:nle03036]
    100583577 (PRKACB)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100583577 (PRKACB)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PKA family
   100583577 (PRKACB)
Messenger RNA biogenesis [BR:nle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100583577 (PRKACB)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100583577 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100583577
NCBI-ProteinID: XP_003260296
Ensembl: ENSNLEG00000009888
UniProt: A0A2I3GCI8
LinkDB
Position
12
AA seq 398 aa
MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaaccaccttgtaaccagtatacaggtacaactacagctcttcag
aaattggaaggttttgctagccggttatttcatagacactctaaaggtactgcacatgat
cagaaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggac
agatcaatgaaagagtttctagccaaagccaaagaagactttttgaaaaaatgggagaat
ccaactcagaataatgccggacttgaagattttgaaaggaaaaaaacccttggaacaggt
tcatttggaagagtcatgttggtaaaacacaaagccactgaacagtattatgccatgaag
atcttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaa
agaatattacaggcagtgaattttcctttccttgttcgactggaatatgcttttaaggat
aattctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcgcatcta
agaagaattggaaggttcagtgagccccatgcacggttctatgcagctcagatagtgcta
acatttgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctc
ttaattgaccatcaaggctatatccaggtcacagactttgggtttgccaaaagagttaaa
ggcagaacttggacattatgtggaactccagagtatttggctccagaaataattctcagc
aagggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggca
gctggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttct
ggaaaggtccgattcccatcccacttcagttcagatctcaaggaccttctacggaacctg
ctgcaggtggatttgaccaagagatttgggaatctaaagaatggtgtcagtgatataaaa
actcacaagtggtttgccacgacagattggattgctatttaccagaggaaggttgaagct
ccattcataccaaagtttagaggctctggagataccagcaactttgatgactatgaagaa
gaagatatccgtgtctctataacagaaaaatgtgcaaaagaatttggtgaattttaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607741
Entry
100607741         CDS       T03265                                 

Gene name
PRKACG
Definition
(RefSeq) LOW QUALITY PROTEIN: cAMP-dependent protein kinase catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04020  Calcium signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04114  Oocyte meiosis
nle04140  Autophagy - animal
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04310  Wnt signaling pathway
nle04340  Hedgehog signaling pathway
nle04371  Apelin signaling pathway
nle04530  Tight junction
nle04540  Gap junction
nle04611  Platelet activation
nle04713  Circadian entrainment
nle04714  Thermogenesis
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04727  GABAergic synapse
nle04728  Dopaminergic synapse
nle04740  Olfactory transduction
nle04742  Taste transduction
nle04750  Inflammatory mediator regulation of TRP channels
nle04910  Insulin signaling pathway
nle04911  Insulin secretion
nle04912  GnRH signaling pathway
nle04913  Ovarian steroidogenesis
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04918  Thyroid hormone synthesis
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04922  Glucagon signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04924  Renin secretion
nle04925  Aldosterone synthesis and secretion
nle04926  Relaxin signaling pathway
nle04927  Cortisol synthesis and secretion
nle04928  Parathyroid hormone synthesis, secretion and action
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle04961  Endocrine and other factor-regulated calcium reabsorption
nle04962  Vasopressin-regulated water reabsorption
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04976  Bile secretion
nle05012  Parkinson disease
nle05020  Prion disease
nle05030  Cocaine addiction
nle05031  Amphetamine addiction
nle05032  Morphine addiction
nle05034  Alcoholism
nle05146  Amoebiasis
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100607741 (PRKACG)
   04014 Ras signaling pathway
    100607741 (PRKACG)
   04310 Wnt signaling pathway
    100607741 (PRKACG)
   04340 Hedgehog signaling pathway
    100607741 (PRKACG)
   04371 Apelin signaling pathway
    100607741 (PRKACG)
   04020 Calcium signaling pathway
    100607741 (PRKACG)
   04024 cAMP signaling pathway
    100607741 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100607741 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100607741 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100607741 (PRKACG)
   04540 Gap junction
    100607741 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100607741 (PRKACG)
   04062 Chemokine signaling pathway
    100607741 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    100607741 (PRKACG)
   04910 Insulin signaling pathway
    100607741 (PRKACG)
   04922 Glucagon signaling pathway
    100607741 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    100607741 (PRKACG)
   04912 GnRH signaling pathway
    100607741 (PRKACG)
   04913 Ovarian steroidogenesis
    100607741 (PRKACG)
   04915 Estrogen signaling pathway
    100607741 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    100607741 (PRKACG)
   04921 Oxytocin signaling pathway
    100607741 (PRKACG)
   04926 Relaxin signaling pathway
    100607741 (PRKACG)
   04935 Growth hormone synthesis, secretion and action
    100607741 (PRKACG)
   04918 Thyroid hormone synthesis
    100607741 (PRKACG)
   04919 Thyroid hormone signaling pathway
    100607741 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    100607741 (PRKACG)
   04916 Melanogenesis
    100607741 (PRKACG)
   04924 Renin secretion
    100607741 (PRKACG)
   04925 Aldosterone synthesis and secretion
    100607741 (PRKACG)
   04927 Cortisol synthesis and secretion
    100607741 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100607741 (PRKACG)
   04270 Vascular smooth muscle contraction
    100607741 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    100607741 (PRKACG)
   04971 Gastric acid secretion
    100607741 (PRKACG)
   04976 Bile secretion
    100607741 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100607741 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100607741 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100607741 (PRKACG)
   04727 GABAergic synapse
    100607741 (PRKACG)
   04725 Cholinergic synapse
    100607741 (PRKACG)
   04728 Dopaminergic synapse
    100607741 (PRKACG)
   04726 Serotonergic synapse
    100607741 (PRKACG)
   04720 Long-term potentiation
    100607741 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    100607741 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    100607741 (PRKACG)
   04742 Taste transduction
    100607741 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    100607741 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    100607741 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    100607741 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100607741 (PRKACG)
   04714 Thermogenesis
    100607741 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607741 (PRKACG)
   05205 Proteoglycans in cancer
    100607741 (PRKACG)
   05203 Viral carcinogenesis
    100607741 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100607741 (PRKACG)
   05020 Prion disease
    100607741 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    100607741 (PRKACG)
   05031 Amphetamine addiction
    100607741 (PRKACG)
   05032 Morphine addiction
    100607741 (PRKACG)
   05034 Alcoholism
    100607741 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100607741 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100607741 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100607741 (PRKACG)
   05163 Human cytomegalovirus infection
    100607741 (PRKACG)
   05165 Human papillomavirus infection
    100607741 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100607741 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100607741 (PRKACG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100607741 (PRKACG)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nle03019]
    100607741 (PRKACG)
   03036 Chromosome and associated proteins [BR:nle03036]
    100607741 (PRKACG)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100607741 (PRKACG)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PKA family
   100607741 (PRKACG)
Messenger RNA biogenesis [BR:nle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100607741 (PRKACG)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100607741 (PRKACG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 100607741
NCBI-ProteinID: XP_004093239
LinkDB
Position
1a
AA seq 343 aa
MGSAPAKKDTEQEESVKEXKARGDFLHRWGNPAHNTAGSDRFERLRTPGAGPFGRVLLLL
RHRETGGHYAMKTLHKQKVVQLRQVEHTLNEKRILQAIDFPFLVKPQFPLKDNSHLYLVT
EKDVLPPARVGRFREPHACFHAAQVVLAFQYLHPLDLIHRGLKPENLLLDLQGYLRVPDF
GFAKRVKGRTWTFXGTPVYLAPEIILSKGYSKAVDWWARGVLIXEMAVGFPPFHAHQPIQ
VYEKIVSGRARFPSKLSSDLKDLLRLLQVDLTKRFGNLRNGVGDTKNHRFATTNWIAICE
KKVEAPLIPKYSGPGDASNFDNYEEEELWISISEKCAKEFSEF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgggcagcgcccccgccaagaaggacaccgagcaggaggagagcgtgaaagagnccaaa
gccagaggagatttcctccaccgatggggaaaccccgctcacaacaccgccggctcggat
cggtttgagcggctcaggacgccgggcgcgggccccttcgggcgggtgctgctgctgctg
aggcaccgggagaccggcggccactacgccatgaagaccctccacaagcagaaggtggtg
cagctgaggcaggtcgagcacacactgaacgagaagcgcatcctgcaggccatcgacttt
cctttcctcgtgaagccgcagttcccccttaaggacaactcccacctgtacctggtgacg
gagaaggatgttctgccaccggcgcgcgtgggaaggttcagggagccccacgcctgtttc
cacgccgcccaggtcgtcctggccttccagtacctgcacccgctcgacctcatccaccgc
ggcctgaagcccgagaatcttctcctcgacctgcagggctacctgcgggtcccggacttt
ggtttcgccaagcgcgtgaagggccgcacttggacctttntggggaccccggtgtacctg
gcccccgagatcatcctgagcaaaggctacagcaaggccgtggactggtgggcccgaggg
gtgctcatctaggagatggccgtgggcttcccacccttccacgcccaccagcccatccag
gtctacgagaagatcgtctctgggagggcgcggtttccctccaaactcagctctgacctc
aaggatctgctgcggctgctgcaggtggacctcaccaagcgcttcggaaatctcaggaac
ggggttggcgacaccaagaaccacaggttcgccacaaccaactggatcgccatctgtgag
aagaaggtggaagctcccttaatcccgaagtactcaggccctggggatgccagtaacttt
gacaactacgaggaggaagagctctggatctccatcagtgagaagtgcgccaaggagttt
tcggagttttag

DBGET integrated database retrieval system