KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100581789
Entry
100581789         CDS       T03265                                 

Gene name
PTCH1
Definition
(RefSeq) protein patched homolog 1 isoform X1
  KO
K06225  patched 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04024  cAMP signaling pathway
nle04340  Hedgehog signaling pathway
nle04360  Axon guidance
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100581789 (PTCH1)
   04024 cAMP signaling pathway
    100581789 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100581789 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100581789 (PTCH1)
   05205 Proteoglycans in cancer
    100581789 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100581789 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 100581789
NCBI-ProteinID: XP_003260566
Ensembl: ENSNLEG00000016755
UniProt: G1S4D5
LinkDB
Position
1a
AA seq 1446 aa
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAF
ALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAAN
LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPA
DPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSAGKLVSAHAL
QTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVL
SFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDL
YRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQS
TVQLRTEYDPHTHVYYTTAEPCSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSL
HCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDI
VPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQL
PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDIS
QLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETR
LRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQ
YIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSA
VPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLML
AGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEP
PPSVVRFAMPPGHMHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATE
NPVFAHSTVVHPESRHHPPSNPRQQPHPDSSLPPGRQGQQPRRDPPREGLWPPPYRLRRD
AFEISTEGHSGPSNRDRWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAV
HPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDMECEERP
RGSSSN
NT seq 4341 nt   +upstreamnt  +downstreamnt
atggcctcggctggtaacgccgccgagccccaggaccgcggcggcggcggcagcggctgt
atcggtgccccgggccggccggctggaggcgggaggcgcagacggacgggggggctgcgc
cgtgctgccgcgccggaccgggactatctgcaccggcccagctactgcgacgccgccttc
gcactggagcagatttccaaggggaaggctactggccggaaagcgccgctgtggctgaga
gcgaagtttcagagactcttatttaaactgggttgttacattcaaaaaaactgcggcaag
ttcttggttgtgggcctcctcatatttggggccttcgcggtgggattaaaggcagcgaac
ctcgagaccaacgtggaggagctgtgggtggaagttggaggacgagtaagtcgagaatta
aattatactcgccagaagattggagaagaggctatgtttaatcctcaactcatgatacag
acccctaaagaggaaggtgctaacgtcctgaccacagaagcgctcctacaacacctggac
tcggcgctccaggccagccgtgtccacgtatacatgtacaacaggcagtggaaattggaa
catttgtgttacaaatcaggagagcttatcacagaaacaggttacatggatcagataata
gaatatctttacccttgtttgattattacacctttggactgcttctgggaaggggcgaaa
ttacagtctgggacagcatacctcctaggtaaacctcctttgcggtggacaaacttcgac
cctttggaattcctagaagagttaaagaaaataaactatcaagtggacagctgggaggaa
atgctgaataaggctgaggttggtcatggttacatggaccgcccctgccttaatccggcc
gatccagactgccccgccacagcccccaacaaaaattcaaccaaacctcttgatatggcc
cttgttttgaatggtggatgtcatggcttatccagaaagtatatgcactggcaggaggag
ttgattgtgggtggcacagtcaagaacagcgctggaaaactcgtcagcgcccacgccctg
cagaccatgttccaattaatgactcccaagcaaatgtacgagcacttcaaggggtacgag
tatgtctcacacatcaactggaacgaggacaaggcggcagccatcctggaggcctggcag
aggacgtatgtggaggtggttcatcagagtgtcgcacagaactccactcaaaaggtgctt
tccttcaccaccacgaccctggacgacatcctgaaatccttctctgacgtcagtgtcatc
cgcgtggccagcggctacttactcatgctcgcctatgcctgtctaaccatgctgcgctgg
gactgctccaagtcccagggtgccgtggggctggctggcgtcctgctggttgcactgtca
gtggctgcaggactgggcctgtgctcattgatcggaatttcctttaacgctgcaacaact
caggttttgccatttctcgctcttggtgttggtgtggatgatgtttttcttctggcccac
gccttcagtgaaaccggacagaataaaagaatcccttttgaggacaggaccggggagtgc
ctgaagcgcacaggagccagcgtggccctcacgtccatcagcaatgtcacagccttcttc
atggccgcgttaatcccaattcccgctctgcgggcgttctccctccaggcagcggtagta
gtggtgttcaattttgccatggttctgctcatttttcctgcaattctcagcatggattta
tatcgacgggaggacaggagactggatattttctgctgttttacaagcccctgcgtcagc
agagtgattcaggttgaacctcaggcctacaccgacacacacgacaatacccgctacagc
cccccacccccctacagcagccacagctttgcccacgaaacacagattaccatgcagtcc
actgtccagctccgcacggagtacgacccccacacgcacgtgtactacaccaccgccgag
ccgtgctctgagatctccgtgcagcccgtcaccgtgacacaggacaccctcagctgccag
agcccagagagcaccagctccacaagggacctgctctcccagttctccgactccagcctc
cactgcctcgagcccccctgtaccaagtggacactctcatcttttgctgagaagcactat
gctcctttcctcttgaaaccaaaagccaaggtagtggtgatcttcctttttctgggcttg
ctgggggtcagcctttatgggaccacccgagtgagagacgggctggaccttacggacatt
gtacctcgggaaaccagagaatatgactttattgctgcacaattcaaatacttttctttc
tacaacatgtatatagtcacccagaaagcagactacccgaatatccagcacttactttac
gaccttcacaggagtttcagtaacgtgaagtatgtcatgttggaagaaaacaaacagctt
cccaaaatgtggctgcactacttcagagactggcttcagggacttcaggatgcatttgac
agtgactgggaaaccgggaaaatcatgccaaacaattacaagaatggatcagatgatgga
gtccttgcctacaaactcctggtgcaaaccggcagccgcgataagcccatcgacatcagc
cagttgactaaacagcgtctggtggatgcagatggcatcattaatcccagcgctttctac
atctacctgacggcttgggtcagcaacgaccccgtcgcgtatgctgcttcccaggccaac
atccggccacaccgaccggaatgggtccacgacaaagccgactacatgcctgaaacaagg
ctgagaatcccggcagcagagcccatcgagtatgcccagttccctttctacctcaacggc
ttgcgggacacctcagactttgtggaggcaattgaaaaagtaaggaccatctgcagcaac
tatacgagcctggggctgtccagttaccccaacggctaccccttcctcttctgggagcag
tacatcggcctccgccactggctgctgctgttcatcagcgtggtgttggcctgcacattc
ctcgtgtgcgccgtcttccttctgaacccctggacggctgggatcattgtgatggtcctg
gcgctgatgacggtcgagctcttcggcatgatgggcctcatcggaattaagctcagcgcc
gtgcccgtggtcatcctgatcgcttctgttggcataggagtggagttcaccgttcacgtt
gctttggcctttctgacggccatcggcgacaagaaccgcagggctgtgcttgccctggag
cacatgtttgcacccgtcctggatggcgccgtgtccactctgctgggagtgctgatgctt
gcgggatctgagttcgacttcattgtcaggtatttctttgctgtgctggcgatcctcacc
atcctcggcgttctcaatgggctggttttgcttcccgtgcttttgtctttctttggacca
tatcctgaggtgtctccagccaatggcttgaaccgcctgcccacaccctcccctgagcca
ccccccagcgtggtccggttcgccatgccccctggccacatgcacagcgggtctgattcc
tccgactcggagtatagttcccagacgacagtgtcaggcctcagcgaggagcttcggcac
tacgaggcccagcagggcgcgggaggccctgcccaccaagtgattgtggaagccacagaa
aaccccgtcttcgcccactccactgtggtccatcccgaatccaggcatcacccaccctcg
aacccacgacagcagccccacccggactcgtccctgcctcccggacggcaaggccagcag
ccccgcagggacccccccagagaaggcttgtggccacccccctacagactgcgcagagac
gcttttgaaatttctactgaagggcattctggccctagcaatagggaccgctggggcccc
cgcggggcccgttctcacaaccctcggaacccagcgtccactgccatgggcagctccgtg
cccggctactgccagcctatcaccactgtgacagcttctgcctccgtgactgtcgccgtg
cacccgccgcctgtccctgggcctgggcggaacccccgaggggggctctgcccgggctac
cctgagactgaccacggcctgttcgaggacccccacgtgcctttccacgtccggtgtgag
aggagggattcgaaggtggaagtcattgagctgcaggacatggagtgcgaggagaggccc
cggggaagcagctccaactga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591053
Entry
100591053         CDS       T03265                                 

Gene name
PTCH2
Definition
(RefSeq) protein patched homolog 2 isoform X1
  KO
K11101  patched 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04340  Hedgehog signaling pathway
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100591053 (PTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100591053 (PTCH2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100591053 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 100591053
NCBI-ProteinID: XP_030679628
Ensembl: ENSNLEG00000014185
LinkDB
Position
12
AA seq 1203 aa
MTRSPPPRELPPSYTPPARTAAPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLF
LGLLAFGALALGLRMAIIETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTSR
QEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLG
GMARDPQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRHFV
QLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVTMLRWDCTQ
SQGAVGLAGVLLVALAVASGLGLCALFGITFNAATTQVLPFLALGIGVDDVFLLAHAFTE
ALPGTPLQERMGECLQRMGTSVVLTSINNMAAFLMAALVPIPALRAFSLQAAIVVGCTFV
AVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSARVIQILPQELGDGTVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLVPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKS
LPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGAFLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYTHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRNWLQGIQAAFDRDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
TRKLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
PAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGVMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTTQGSRNLRAARALEHTFAPVTDGAISTLLGLLMLAGSH
FDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKESPEVLSPPAPQGGG
LRWGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPASDEPPWSPAATSSGNLSSRGPGP
ATG
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgactcgatcgccgccccccagagagctgcccccgagttacacacccccagctcgaacc
gcagcaccccagatcctagctgggagcctgaaggctccgctctggcttcgtgcttacttc
cagggcctgctcttctctctgggatgcggcatccagagacactgtggcaaagtgctcttt
ctgggactgttggcctttggggccctggcattaggtctccgcatggccattattgagaca
aacttggaacagctctgggtagaagtgggcagccgggtgagccaggagctgcattacacc
aaggagaagctgggggaggaggctgcatacacctctcagatgctgatacagacctctcgc
caggagggcgagaacatcctcacgcccgaagcacttggcctccacctccaggcagccctc
actgccagtaaagtccaagtatcactctatgggaagtcctgggatttgaacaaaatctgc
tacaagtcaggagttccccttattgaaaatggaatgattgagcggatgattgagaagctg
tttccgtgtgtgatcctcaccccccttgactgcttctgggagggagccaaactccaaggg
ggctccgcctatctgcccggccgcccagatatccagtggaccaacctggacccagagcag
ctgctggaggagctgggtccctttgcctcccttgagggcttccgggagttgctagacaag
gcacaggtgggccaggcctacgtggggcggccttgtctgcaccctgatgacctccactgc
ccacctagtgcccccaaccatcacagcaggcaggctcccaatgtggctcacgagctgagc
gggggctgccacggcttctcccacaaattcatgcactggcaggaggaactgctgctggga
ggcatggccagagacccccaaggacagctgctgagggcagaggccctgcagagcaccttc
ttgctgatgagtccccgccagctgtacgagcatttccggggtgactatcagacgcatgac
attggctggagtgaggagcaggccagcacagtgctacaagcctggcagcggcactttgtg
cagctggcccaggaggccttgcctgagaacgcttcccagcagatccacgccttctcctcc
accaccctggatgacatcctgcatgcgttctctgaagtcagtgctgcccgtgtggtggga
ggctatctgctcatgctggcctatgcctgtgtgaccatgctgcggtgggactgcacccag
tcccagggtgccgtgggccttgccggggtactgctggtggccctggcggtggcctcaggc
cttgggctctgtgccctgttcggcatcaccttcaatgctgccactacccaggtgctgccc
ttcttggctctgggaatcggcgtagatgacgtattcctgctggcgcacgccttcacagag
gctctgcctggcacccctctccaggagcgcatgggcgagtgtctgcagcgcatgggcacc
agtgtcgtactcacatccatcaacaacatggccgccttcctcatggctgccctcgttccc
atccctgcgctgcgagccttctccctacaggcggccatagtggttggctgcacctttgta
gccgtgatgcttgtcttcccagccatcctcagcctggacctacggcggcgccactgccag
cgccttgatgtgctctgctgcttctccagtccctgctctgctcgggtgattcagatcctg
ccccaggagctgggggacgggacggtaccagtgggcattgcccacctcactgccaccgtt
caagcctttacccactgtgaagccagcagccagcatgtggtcaccatcctgcctccccaa
gcccacctggtgcccccaccttctgacccactgggctctgagctcttcagccctggaggg
tccacacgggaccttctaggccaggaggaggagacaaggcagaaggcagcctgcaagtcc
ctgccctgtgcccgctggaatcttgcccatttcgcccgctatcagtttgctcccttgctg
ctccagtcacatgccaaggccatcgtgctggtgctctttggcgcttttctgggcctgagc
ctctacggagccaccttggtgcaagacggcctggccctgacggatgtggtgcctcggggc
accaaggagcatgccttcctgagcgcccagctcaggtacttctccctgtacgaggtggcc
ctggtgacccagggtggctttgactacacccactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggcggtgctgcccccaccggccacccaggcaccccgcacc
tggctgcactattaccgcaactggctacaaggaatccaggctgcctttgaccgggactgg
gcttctgggcgcatcacccgccactcgtaccgcaatggctctgaggatggggccctggcc
tacaagctgctcatccagaccggagacgcccaggagcctctggatttcagccagctgacc
acaaggaagctggtggacagagagggactgattccacctgagctcttctacatggggctg
actgtgtgggtgagcagtgaccccctgggtctggcagcctcacaggccaacttctacccc
ccacctcctgaatggctgcatgacaaatacgacaccaccggggagaaccttcgcatccca
ccagctcagcccttggagtttgcccagttccccttcctgctgcgtggcctccagaagact
gcagactttgtggaggccatcgagggggcccgggcagcatgcgcagaggccggccaggct
ggggtgcacgcctaccccagcggctcccccttcctcttctgggagcagtatctgggcctg
cggcgctgcttcctgctggctgtctgcattctgctggtgtgcactttcctcgtctgtgcc
ctgctgctcctcaacccctggacagctggcctcatagtgctggtcctggcgatgatgaca
gtggaactctttggtgtcatgggtttcctgggcatcaagctgagcgccatccccgtggtg
atccttgtggcctctgtaggcatcggcgttgagttcacagtccacgtggctctgggcttc
ctgaccacccagggcagccggaacctgcgagccgcccgtgcccttgagcacacatttgcc
cccgtgaccgatggggccatctccacattgctgggtctgctcatgcttgctggttcccac
tttgacttcattgtaaggtacttctttgcggcgctgacggtgcttacgctcctgggcctc
ctccatggactcgtgctgctgcctgtgctgctgtccatcctggggccaccaccagaggtg
atacagatgtacaaggaaagcccagaggtcctgagtccaccagctccacagggaggcggg
cttaggtggggggcatcctcctccctgccccagagctttgccagagtgactacctccatg
accgtggccatccacccaccccccctgcctggtgcctacatccatccagcctctgatgag
cccccttggtcccctgctgccaccagctctggcaacctcagttccaggggaccaggtcca
gccactgggtga

DBGET integrated database retrieval system