KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100583002
Entry
100583002         CDS       T03265                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04015  Rap1 signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04510  Focal adhesion
nle04520  Adherens junction
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04670  Leukocyte transendothelial migration
nle04916  Melanogenesis
nle04919  Thyroid hormone signaling pathway
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05100  Bacterial invasion of epithelial cells
nle05132  Salmonella infection
nle05160  Hepatitis C
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100583002 (CTNNB1)
   04310 Wnt signaling pathway
    100583002 (CTNNB1)
   04390 Hippo signaling pathway
    100583002 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100583002 (CTNNB1)
   04520 Adherens junction
    100583002 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100583002 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100583002 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100583002 (CTNNB1)
   04916 Melanogenesis
    100583002 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100583002 (CTNNB1)
   05205 Proteoglycans in cancer
    100583002 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100583002 (CTNNB1)
   05225 Hepatocellular carcinoma
    100583002 (CTNNB1)
   05226 Gastric cancer
    100583002 (CTNNB1)
   05216 Thyroid cancer
    100583002 (CTNNB1)
   05217 Basal cell carcinoma
    100583002 (CTNNB1)
   05215 Prostate cancer
    100583002 (CTNNB1)
   05213 Endometrial cancer
    100583002 (CTNNB1)
   05224 Breast cancer
    100583002 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100583002 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100583002 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100583002 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100583002 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100583002 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100583002 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    100583002 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100583002 (CTNNB1)
   05163 Human cytomegalovirus infection
    100583002 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100583002 (CTNNB1)
   05165 Human papillomavirus infection
    100583002 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100583002
NCBI-ProteinID: XP_003256950
Ensembl: ENSNLEG00000005726
UniProt: G1R1B9
LinkDB
Position
4
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgtcagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagagcaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttcccc
gagacgttagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgacgaggaccaggtggtggtgaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac
ctttcccatcatcgtgagggcttactggccatctttaagtctggagggattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcaaattttagcttacggcaaccaagaaagcaagctcatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttatgaaaaactactgtggaccaca
agcagagtgctgaaggtgctatcagtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgccttcactatggactaccagttgtggttaagctcttacaccca
ccatcccactggcctctgataaaggctaccgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtaccggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcaggggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctttgtgaa
cttgctcaggataaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacgtatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacacgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system